Property Summary

NCBI Gene PubMed Count 519
Grant Count 215
R01 Count 120
Funding $16,423,970.34
PubMed Score 283.88
PubTator Score 2021.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.100 0.008
ependymoma -1.200 0.009
oligodendroglioma -1.200 0.006
diabetes mellitus 2.100 0.001
ovarian cancer 1.500 0.000

Synonym

Accession P40337 B2RE45 Q13599 Q6PDA9
Symbols RCA1
VHL1
pVHL
HRCA1

Gene

VHL

PANTHER Protein Class (1)

PDB

4WQO   1LM8   1LQB   1VCB   3ZRC   3ZRF   3ZTC   3ZTD   3ZUN   4AJY   4AWJ   4B95   4B9K   4BKS   4BKT   4W9C   4W9D   4W9E   4W9F   4W9G   4W9H   4W9I   4W9J   4W9K   4W9L  

Gene RIF (445)

PMID Text
26735018 ID2 binds to the VHL ubiquitin ligase complex, displaces VHL-associated Cullin 2, and impairs HIF2alpha ubiquitylation and degradation
26647960 HBV induces the HIF2alpha expression through its encoded protein HBx. This upregulates the HIF-2alpha expression by binding to the pVHL activating the NF-kappaB signaling pathway
26620126 VHL was shown to influence cellular metabolism through its effect on HIF proteins as well as by affecting activity of other factors.
26591561 Hereditary pheochromocytoma / paraganglioma associated with VHL gene mutations has more aggressive course,bilateral adrenal involvement, higher recurrence rate, younger age at disease manifestations.
26572705 inhibition of miR566 expression increases the expression levels of VHL, decreases the expression levels of VEGF, and inhibits the invasive and migratory abilities of glioblastoma.
26506913 proteome and phospho-proteomic analysis of isogenic 786-O renal cell carcinoma (+/-VHL) cells to compare signatures that reflect hypoxia and/or loss of VHL protein
26308528 Pars plana vitrectomy in advanced VHL eye disease can improve or preserve visual function, but postoperative progression of ocular VHL disease can be accelerated in cases where retinotomy is performed.
26304926 AR-suppressed miRNA-145 is a key player in renal cell carcinoma progression by regulating HIF2alpha/VEGF/MMP9/CCND1 expression levels, irrespective of VHL status.
26296657 pVHL interacts with CERKL and ubiquitinates it for oxygen dependent proteasomal degradation.
26224408 VHLp19 has a role for regulating EPO levels that VHLp30 does not have, whereas VHLp30 is really the tumor suppressor isoform.
More...

AA Sequence

MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSRE      1 - 70
PSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSL     71 - 140
NVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQR    141 - 210
MGD                                                                       211 - 213
//

Publication (527)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26735018 2016 An ID2-dependent mechanism for VHL inactivation in cancer.
26647960 2016 Hepatitis B virus induces hypoxia-inducible factor-2? expression through hepatitis B virus X protein.
26620126 2016 (1)H NMR metabolomics analysis of renal cell carcinoma cells: Effect of VHL inactivation on metabolism.
26591561 2015 [Hereditary pheochromocytoma-associated syndromes. Part 1].
26572705 2016 MicroRNA?566 modulates vascular endothelial growth factor by targeting Von Hippel?Landau in human glioblastoma in vitro and in vivo.
26506913 2015 Combined Analyses of the VHL and Hypoxia Signaling Axes in an Isogenic Pairing of Renal Clear Cell Carcinoma Cells.
26308528 2016 PARS PLANA VITRECTOMY IN ADVANCED CASES OF VON HIPPEL-LINDAU EYE DISEASE.
26304926 2015 Androgen receptor (AR) suppresses miRNA-145 to promote renal cell carcinoma (RCC) progression independent of VHL status.
26296657 2015 pVHL interacts with Ceramide kinase like (CERKL) protein and ubiquitinates it for oxygen dependent proteasomal degradation.
More...