Property Summary

Ligand Count 4
NCBI Gene PubMed Count 10
PubMed Score 1283.55
PubTator Score 80.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV      1 - 70
VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV     71 - 140
CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC    141 - 210
QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN                    211 - 264
//

Text Mined References (10)

PMID Year Title