Tchem | Chymotrypsin-like protease CTRL-1 |
This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Cancer | 2346 | 4.336 | 2.2 |
Severe acute respiratory syndrome | 26 | 4.194 | 2.1 |
JMP syndrome | 2 | 3.902 | 2.0 |
Muscular atrophy | 67 | 3.326 | 1.7 |
Periodontal disease | 37 | 3.025 | 1.5 |
Accession | P40313 |
Symbols |
CTRL1 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
25578495 | We found CT-like activity to be an independent predictor of high-risk PCa, and as such, it may be a good candidate as a biomarker for high-risk PCa detection and stratification. |
MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV 1 - 70 VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV 71 - 140 CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC 141 - 210 QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN 211 - 264 //
PMID | Year | Title |
---|---|---|
25578495 | 2015 | Plasma proteasomal chymotrypsin-like activity correlates with prostate cancer progression. |
25056061 | 2014 | Biological insights from 108 schizophrenia-associated genetic loci. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
12231569 | 2002 | Mast cell chymase degrades apoE and apoA-II in apoA-I-knockout mouse plasma and reduces its ability to promote cellular cholesterol efflux. |
9065485 | 1997 | A novel human chymotrypsin-like digestive enzyme. |
8812482 | 1996 | Molecular cloning, expression pattern, and chromosomal localization of the human Na-Cl thiazide-sensitive cotransporter (SLC12A3). |
8268911 | 1993 | A tight cluster of five unrelated human genes on chromosome 16q22.1. |
8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |