Property Summary

NCBI Gene PubMed Count 10
Grant Count 103
R01 Count 67
Funding $12,864,903.89
PubMed Score 1231.58
PubTator Score 80.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P40313
Symbols CTRL1

Gene

PANTHER Protein Class (3)

Gene RIF (1)

PMID Text
25578495 We found CT-like activity to be an independent predictor of high-risk PCa, and as such, it may be a good candidate as a biomarker for high-risk PCa detection and stratification.

AA Sequence

MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWV      1 - 70
VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPV     71 - 140
CLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSC    141 - 210
QGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN                    211 - 264
//

Text Mined References (10)

PMID Year Title
25578495 2015 Plasma proteasomal chymotrypsin-like activity correlates with prostate cancer progression.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231569 2002 Mast cell chymase degrades apoE and apoA-II in apoA-I-knockout mouse plasma and reduces its ability to promote cellular cholesterol efflux.
9065485 1997 A novel human chymotrypsin-like digestive enzyme.
8812482 1996 Molecular cloning, expression pattern, and chromosomal localization of the human Na-Cl thiazide-sensitive cotransporter (SLC12A3).
8268911 1993 A tight cluster of five unrelated human genes on chromosome 16q22.1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.