Property Summary

Ligand Count 1
NCBI Gene PubMed Count 52
PubMed Score 74.32
PubTator Score 38.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 2.4

Expression

 GWAS Trait (1)

Gene RIF (35)

AA Sequence

MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSC      1 - 70
EKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVG     71 - 140
GVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGG    141 - 210
NVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE           211 - 273
//

Text Mined References (63)

PMID Year Title