Property Summary

NCBI Gene PubMed Count 42
Grant Count 6
R01 Count 3
Funding $1,111,364.5
PubMed Score 31.67
PubTator Score 696.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
27100186 IFI27 mRNA level is reduced in peripheral blood mononuclear cells of immunoglobulin A nephropathy and membranous nephropathy patients.
26116899 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
25664647 IFI27 is involved in proliferation of skin keratinocytes both in vitro and in vivo.
25170834 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
25103640 We found that IFI27 is overexpressed in ovarian cancer and associated with patients' survival.
24999841 These results suggest that high basal ISG12a may inhibit Newcastle disease virus replication and oncolysis, while low basal ISG12a may allow sufficient Newcastle disease virus replication for induction of ISG12a.
24970806 Data indicate that AKT control TRAIL resistance of cancer cells through downregulation of interferon stimulated gene 12a (ISG12a) by MicroRNA-942 (miR-942).
24742347 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
24742347 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
24727952 MiR-942 regulates hepatitis c virus-induced apoptosis of human hepatocytes by targeting ISG12a.
More...

AA Sequence

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSA      1 - 70
AAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY                          71 - 119
//

Text Mined References (42)

PMID Year Title
27100186 2016 IFI27 Is a Useful Genetic Marker for Diagnosis of Immunoglobulin A Nephropathy and Membranous Nephropathy Using Peripheral Blood.
25664647 2015 IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes.
25103640 2015 Interferon alpha-inducible protein 27 promotes epithelial-mesenchymal transition and induces ovarian tumorigenicity and stemness.
24999841 2014 ISG12a mediates cell response to Newcastle disease viral infection.
24970806 2014 miR-942 decreases TRAIL-induced apoptosis through ISG12a downregulation and is regulated by AKT.
24727952 2014 MiR-942 mediates hepatitis C virus-induced apoptosis via regulation of ISG12a.
23959120 2013 The association of IFI27 expression and fatigue intensification during localized radiation therapy: implication of a para-inflammatory bystander response.
23383510 2012 [Effect of autophagy on expression of interferon in hepatitis B virus-infected hepatocytes].
22427340 2012 The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors.
22320196 2012 Interferon-inducible genes, TNF-related apoptosis-inducing ligand (TRAIL) and interferon inducible protein 27 (IFI27) are negatively regulated in leiomyomas: implications for a role of the interferon pathway in leiomyoma development.
More...