Property Summary

NCBI Gene PubMed Count 44
PubMed Score 33.30
PubTator Score 696.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Influenza, Human 51 0.0 0.0
Disease Target Count
Influenza 142
Disease Target Count Z-score Confidence
Hepatitis C 94 3.771 1.9

Expression

  Differential Expression (37)

Gene RIF (29)

AA Sequence

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSA      1 - 70
AAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY                          71 - 119
//

Text Mined References (44)

PMID Year Title