Property Summary

NCBI Gene PubMed Count 42
PubMed Score 31.67
PubTator Score 696.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
psoriasis 6685 3.58858751945235E-195
lung carcinoma 2844 4.18643430863764E-22
juvenile dermatomyositis 1189 1.28588533429689E-21
malignant mesothelioma 3163 2.11942842962983E-9
Breast cancer 3099 2.31748387429927E-9
pancreatic cancer 2300 3.19105296150272E-7
lung cancer 4473 2.66943526452431E-6
cutaneous lupus erythematosus 1056 2.6964141022355E-6
Atopic dermatitis 944 1.81746659073562E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.64076788162406E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.12992425423883E-4
Duchenne muscular dystrophy 602 1.14638786163598E-4
primary Sjogren syndrome 789 1.33475443195647E-4
medulloblastoma, large-cell 6234 1.56584994386835E-4
group 4 medulloblastoma 1875 1.65666430104941E-4
ovarian cancer 8492 1.95152599421104E-4
interstitial cystitis 2299 2.06409027968512E-4
cystic fibrosis 1670 2.16619447269597E-4
nephrosclerosis 329 6.80410385773768E-4
systemic lupus erythematosus 172 7.63275410902909E-4
dermatomyositis 967 0.00176244533547105
primary pancreatic ductal adenocarcinoma 1271 0.00359999267523178
Multiple Sclerosis 498 0.00362406570445443
breast carcinoma 1614 0.00458947046186333
active Crohn's disease 918 0.00523347763873894
limb girdle muscular dystrophy 2I 56 0.00910786634119494
tuberculosis and treatment for 3 months 327 0.0109533664281805
mucosa-associated lymphoid tissue lymphoma 480 0.0127936042465548
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0131265208393645
posterior fossa group A ependymoma 1511 0.0160019681379804
esophageal adenocarcinoma 737 0.0176010007179145
pituitary cancer 1972 0.021597482312521
subependymal giant cell astrocytoma 2287 0.0243110777933024
COPD 116 0.0260433041140237
active ulcerative colitis 477 0.0272161853400843
Gaucher disease type 3 76 0.0312334463879169
Barrett's esophagus 185 0.0350406242245978
Disease Target Count Z-score Confidence
Hepatitis C 90 3.767 1.9

Expression

Synonym

Accession P40305 Q53YA6 Q6IEC1 Q96BK3 p27
Symbols P27
ISG12
FAM14D
ISG12A

Gene

Gene RIF (27)

PMID Text
27100186 IFI27 mRNA level is reduced in peripheral blood mononuclear cells of immunoglobulin A nephropathy and membranous nephropathy patients.
26116899 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
25664647 IFI27 is involved in proliferation of skin keratinocytes both in vitro and in vivo.
25170834 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
25103640 We found that IFI27 is overexpressed in ovarian cancer and associated with patients' survival.
24999841 These results suggest that high basal ISG12a may inhibit Newcastle disease virus replication and oncolysis, while low basal ISG12a may allow sufficient Newcastle disease virus replication for induction of ISG12a.
24970806 Data indicate that AKT control TRAIL resistance of cancer cells through downregulation of interferon stimulated gene 12a (ISG12a) by MicroRNA-942 (miR-942).
24742347 HIV-1 Vpr upregulates the gene expression of IFI27 in human monocyte-derived dendritic cells
24727952 MiR-942 regulates hepatitis c virus-induced apoptosis of human hepatocytes by targeting ISG12a.
23959120 Alterations in mechanisms associated with immune response and mitochondrial function that explain the up-regulation of IFI27 may provide an understanding of the pathways related to the intensification of fatigue during localized radiation therapy.
More...

AA Sequence

MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSA      1 - 70
AAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY                          71 - 119
//

Text Mined References (42)

PMID Year Title
27100186 2016 IFI27 Is a Useful Genetic Marker for Diagnosis of Immunoglobulin A Nephropathy and Membranous Nephropathy Using Peripheral Blood.
25664647 2015 IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes.
25103640 2015 Interferon alpha-inducible protein 27 promotes epithelial-mesenchymal transition and induces ovarian tumorigenicity and stemness.
24999841 2014 ISG12a mediates cell response to Newcastle disease viral infection.
24970806 2014 miR-942 decreases TRAIL-induced apoptosis through ISG12a downregulation and is regulated by AKT.
24727952 2014 MiR-942 mediates hepatitis C virus-induced apoptosis via regulation of ISG12a.
23959120 2013 The association of IFI27 expression and fatigue intensification during localized radiation therapy: implication of a para-inflammatory bystander response.
23383510 2012 [Effect of autophagy on expression of interferon in hepatitis B virus-infected hepatocytes].
22427340 2012 The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors.
22320196 2012 Interferon-inducible genes, TNF-related apoptosis-inducing ligand (TRAIL) and interferon inducible protein 27 (IFI27) are negatively regulated in leiomyomas: implications for a role of the interferon pathway in leiomyoma development.
More...