Property Summary

Ligand Count 1
NCBI Gene PubMed Count 70
PubMed Score 121.91
PubTator Score 99.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (61)

AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ      1 - 70
LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK     71 - 140
CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK    141 - 210
FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL                    211 - 264
//

Text Mined References (73)

PMID Year Title