Property Summary

NCBI Gene PubMed Count 60
Grant Count 17
R01 Count 11
Funding $1,479,466.28
PubMed Score 108.99
PubTator Score 99.65

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

PMID Text
26571212 Data show that nicotinamide N-methyltransferase (NNMT) and the metabolic state regulate pluripotency in embryonic stem cells (hESCs).
26456643 results further reinforce a central role for NNMT in the regulation of energy homeostasis and provide further mechanistic insight into the consequences of enhanced NNMT expression
26168293 increasing Nnmt expression or MNAM levels stabilizes sirtuin 1 protein, an effect that is required for their metabolic benefits
25596852 White adipose tissue NNMT expression is regulated in human insulin resistance and type 2 diabetes and that plasma MNA correlates with increased tissue NNMT expression and the degree of insulin resistance.
25592232 Data sugguest that NNMT plays an important role in PANC-1 cell proliferation, metastatic potential and survival under metabolic stress.
25547204 There were no associations between MTHFR C677T, NNMT rs694539 AG/AA polymorphisms and conotruncal heart disease.
25317069 results suggest that the NNMT SNP rs694539 may have a role in the etiology of schizophrenia in a Han Chinese female population
25204218 The downregulation of NNMT significantly reduced in vitro tumorigenicity of A549 cells.
25201588 NNMT enhances the capacity of tumorigenesis associated with the inhibition of cell apoptosis and the promotion of cell cycle progression in human colorectal cancer cells
25115443 NNMT is associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis.
More...

AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ      1 - 70
LLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLK     71 - 140
CDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQK    141 - 210
FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL                    211 - 264
//

Text Mined References (63)

PMID Year Title
26571212 2015 The metabolome regulates the epigenetic landscape during naive-to-primed human embryonic stem cell transition.
26456643 2015 Nicotinamide N-methyltransferase increases complex I activity in SH-SY5Y cells via sirtuin 3.
26168293 2015 Nicotinamide N-methyltransferase regulates hepatic nutrient metabolism through Sirt1 protein stabilization.
25596852 2015 Association of nicotinamide-N-methyltransferase mRNA expression in human adipose tissue and the plasma concentration of its product, 1-methylnicotinamide, with insulin resistance.
25592232 2015 Effects of nicotinamide N-methyltransferase on PANC-1 cells proliferation, metastatic potential and survival under metabolic stress.
25547204 2015 Association of MTHFR A1298C polymorphism with conotruncal heart disease.
25317069 2014 Female specific association between NNMT gene and schizophrenia in a Han Chinese population.
25204218 2015 Role of nicotinamide N-methyltransferase in non-small cell lung cancer: in vitro effect of shRNA-mediated gene silencing on tumourigenicity.
25201588 2014 Nicotinamide N-methyltransferase enhances the capacity of tumorigenesis associated with the promotion of cell cycle progression in human colorectal cancer cells.
25115443 2014 N-methylnicotinamide and nicotinamide N-methyltransferase are associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis.
More...