Property Summary

NCBI Gene PubMed Count 60
Grant Count 115
R01 Count 53
Funding $17,103,274.72
PubMed Score 315.42
PubTator Score 181.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.654 0.000
interstitial cystitis 1.900 0.005
nasopharyngeal carcinoma -1.600 0.001
pituitary cancer -3.600 0.000

Synonym

Accession P40259 Q53FS2 Q9BU06
Symbols B29
IGB
AGM6

Gene

PDB

3KG5  

 GWAS Trait (1)

Gene RIF (30)

PMID Text
26752547 MYD88 L265P and CD79B mutations were frequently detected in primary breast diffuse large B-cell lymphoma.
25501023 Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations.
25414443 Abberant expression of CD79b in non-B cells caused unwanted reactivity, rendering CD79b unsuitable for T-cell receptor - based immunotherapies.
25347427 Oncogenic CD79B mutation is associated with primary diffuse large B-cell lymphomas of central nervous system.
24769851 Phosphorylation of CD79a causes a decrease in helical propensity in the C-terminal region, for CD79b, the opposite was observed and phosphorylation resulted in an increase of helical propensity in the C-terminal part.
24444466 CD79B and MYD88 mutations are associated with an older age at onset in diffuse large b-cell lymphoma with a significant overlap, which did not affect the outcome of the disease.
24253023 results suggest that MYD88 mutations, and to a lesser extent CD79B mutations, are important drivers of lymphomagenesis in PTL
23649625 Data indicate a secondary promoter located within exon 2 maintained full levels and specificity of hCD79b transcription.
23361872 CD79B point mutation is associated with B-cell non-Hodgkin lymphomas.
22808296 The present study failed to find any mut-ation in MYD88, CARD11 or CD79B in ocular MALT lymphoma.
More...

AA Sequence

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA      1 - 70
SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL     71 - 140
RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI    141 - 210
VTLRTGEVKWSVGEHPGQE                                                       211 - 229
//

Text Mined References (66)

PMID Year Title
26752547 2016 Frequent MYD88 L265P and CD79B Mutations in Primary Breast Diffuse Large B-Cell Lymphoma.
25501023 2014 Diffuse large B cell lymphomas relapsing in the CNS lack oncogenic MYD88 and CD79B mutations.
25416956 2014 A proteome-scale map of the human interactome network.
25414443 2015 Therapeutic targeting of the BCR-associated protein CD79b in a TCR-based approach is hampered by aberrant expression of CD79b.
25347427 2015 Primary diffuse large B-cell lymphomas of central nervous system exhibit remarkably high prevalence of oncogenic MYD88 and CD79B mutations.
24769851 2014 Tyrosine phosphorylation within the intrinsically disordered cytosolic domains of the B-cell receptor: an NMR-based structural analysis.
24444466 2014 CD79B and MYD88 mutations in diffuse large B-cell lymphoma.
24253023 2014 High prevalence of oncogenic MYD88 and CD79B mutations in primary testicular diffuse large B-cell lymphoma.
23649625 2013 Identification of a secondary promoter within the human B cell receptor component gene hCD79b.
23361872 2013 EZH2 and CD79B mutational status over time in B-cell non-Hodgkin lymphomas detected by high-throughput sequencing using minimal samples.
More...