Property Summary

NCBI Gene PubMed Count 167
Grant Count 185
R01 Count 102
Funding $22,700,027.68
PubMed Score 584.70
PubTator Score 602.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P40238 Q5JUZ0 TPO-R
Symbols MPLV
TPOR
C-MPL
CD110
THCYT2

Gene

MPL

Gene RIF (162)

PMID Text
26890983 In essential thrombocythemia, MPL mutations might be associated with a higher risk of fibrotic transformation and the presence of JAK2/MPL mutations with higher risk of thrombosis.
26817954 mutant CALR promotes myeloproliferative neoplasm development by activating c-MPL and its downstream pathway.
26668133 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26627830 His(499) regulates the activation of human TpoR and provides additional protection against activating mutations, such as oncogenic Asn mutations in the TM domain
26614694 Compared to normal controls, the frequency of the JAK246/1 haplotype was significantly higher among patients with JAK2V617F, JAK2Ex12del, or MPL mutations, whereas no significant difference was found among CALR mutation-positive patients
26505790 Using C-mannosylation defective mutant of c-Mpl, the C-mannosylated tryptophan residues at four sites (Trp(269), Trp(272), Trp(474), and Trp(477)) are essential for c-Mpl-mediated JAK-STAT signaling.
26450985 this study has shown that in a fraction of the so-called triple-negative ETs a significant proportion of patients have mutations in signaling molecules, more particularly in MPL.
26314963 PARP-1 has an important role in the progression of acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene
26159733 erythrocyte lineage enforces exclusivity through upregulation of EKLF and its lineage-specific cytokine receptor (EpoR) while inhibiting both FLI-1 and the receptor TpoR (also known as MPL) for the opposing megakaryocyte lineage
26071474 The data supports the proposal of including MPL exon 10 mutations as major diagnostic markers for myeloproliferative neoplasms.
More...

AA Sequence

MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYP      1 - 70
REKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIK     71 - 140
AMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSP    141 - 210
CAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDL    211 - 280
PGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFS    281 - 350
RCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE    351 - 420
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETA    421 - 490
WISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTC    491 - 560
EEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLS    561 - 630
YWQQP                                                                     631 - 635
//

Publication (169)

PMID Year Title
26890983 2016 Calreticulin variant stratified driver mutational status and prognosis in essential thrombocythemia.
26817954 2016 Activation of the thrombopoietin receptor by mutant calreticulin in CALR-mutant myeloproliferative neoplasms.
26668133 2016 Thrombopoietin receptor activation by myeloproliferative neoplasm associated calreticulin mutants.
26627830 2016 His499 Regulates Dimerization and Prevents Oncogenic Activation by Asparagine Mutations of the Human Thrombopoietin Receptor.
26614694 2016 Clinical features of Japanese polycythemia vera and essential thrombocythemia patients harboring CALR, JAK2V617F, JAK2Ex12del, and MPLW515L/K mutations.
26505790 2015 C-Mannosylation of thrombopoietin receptor (c-Mpl) regulates thrombopoietin-dependent JAK-STAT signaling.
26450985 2016 Presence of atypical thrombopoietin receptor (MPL) mutations in triple-negative essential thrombocythemia patients.
26314963 2015 Inhibition of poly(ADP-ribose) polymerase 1 protects against acute myeloid leukemia by suppressing the myeloproliferative leukemia virus oncogene.
26159733 2015 Robust hematopoietic progenitor cell commitment in the presence of a conflicting cue.
26071474 2015 The Prevalence of JAK2, MPL, and CALR Mutations in Chinese Patients With BCR-ABL1-Negative Myeloproliferative Neoplasms.
More...