Property Summary

Ligand Count 35
NCBI Gene PubMed Count 179
PubMed Score 582.03
PubTator Score 602.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Thrombocytopenia 197
Anemia 365
Abdominal Pain 98
Abnormal hemoglobin finding 8
Abnormally-shaped vertebrae 31
Acquired scoliosis 281
Acute blood cancer 6
Acute leukemia 15
Amaurosis Fugax 8
Amegakaryocytic thrombocytopenia 6
Angina Pectoris 32
Arterial thrombosis 9
Arthralgia 90
Autosomal recessive predisposition 1442
Bleeding tendency 37
Bleeding time prolonged 31
Cerebellar vermis hypoplasia 24
Chest Pain 38
Coarse facial features 108
Curvature of spine 282
Decreased platelet count 111
Dizziness 26
Ecchymosis 66
Epistaxis 43
Fatigue 182
Gingival Hemorrhage 18
Headache 37
Hemoglobin low 124
Hepatomegaly 285
Hyperhidrosis disorder 81
Hypoplastic myelodysplasia 18
Increased megakaryocyte count 6
Increased number of platelets 14
Increased sweating 81
Increased tendency to bruise 66
MYELODYSPLASTIC SYNDROME 53
Megakaryocytopenia 2
Melanocytic nevus 43
Myeloproliferative disease 16
Myocardial Infarction 151
Noncancerous mole 28
Pancytopenia 45
Paresthesia 32
Peripheral arterial occlusive disease 4
Peripheral vascular insufficiency 4
Platelet morphology abnormal 9
Pruritus 58
Respiratory Insufficiency 132
Respiratory function loss 121
Short neck 140
Short stature 531
Somatic mutation 61
Splenomegaly 190
Sweating 81
THROMBOCYTHEMIA 1 3
THROMBOCYTHEMIA 3 3
Thickened facial skin with coarse facial features 108
Thrombocythemia, Essential 12
Tinnitus 19
Transient Cerebral Ischemia 25
Venous Thrombosis 47
Vertigo 29
Weight decreased 103
vascular disease occlusive 4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Hematologic cancer 12 0.0 2.2
Immune system cancer 140 0.0 2.2

Expression

Protein-protein Interaction (1)

Gene RIF (174)

AA Sequence

MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQLLYAYP      1 - 70
REKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIK     71 - 140
AMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTGPTVIQLIATETCCPALQRPHSASALDQSP    141 - 210
CAQPTMPWQDGPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDL    211 - 280
PGDAVALGLQCFTLDLKNVTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFS    281 - 350
RCHFKSRNDSIIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE    351 - 420
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETA    421 - 490
WISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAALSPPKATVSDTC    491 - 560
EEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLGTMPLSVCPPMAESGSCCTTHIANHSYLPLS    561 - 630
YWQQP                                                                     631 - 635
//

Text Mined References (181)

PMID Year Title