Property Summary

NCBI Gene PubMed Count 24
Grant Count 4
Funding $880,271.67
PubMed Score 23.85
PubTator Score 11.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.214 0.019
Multiple myeloma 1.949 0.001
glioblastoma 1.600 0.008
group 3 medulloblastoma 1.300 0.001
medulloblastoma, large-cell 1.400 0.000
acute quadriplegic myopathy 1.654 0.000
non-small cell lung cancer 1.146 0.000
colon cancer 1.200 0.032
lung cancer 1.800 0.000
breast carcinoma 1.700 0.007
pediatric high grade glioma 1.200 0.000
lung adenocarcinoma 1.107 0.000
ovarian cancer 2.500 0.000
Breast cancer 1.100 0.000
dermatomyositis 1.300 0.002

Synonym

Accession P40227 A6NCD2 Q3KP28 Q75LP4 Q96S46 TCP-1-zeta
Symbols CCT6
Cctz
HTR3
TCPZ
TCP20
MoDP-2
TTCP20
CCT-zeta
CCT-zeta-1
TCP-1-zeta

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of chaperonin containing TCP1, subunit 6A (CCT6A) in the nucleoli of Jurkat T-cells
16211299 identified genes, which include Tcp20, may play important role in conferring radioresistance to oral squamous cell carcinoma and could be useful in identifying cases with more radioresistance

AA Sequence

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQ      1 - 70
HPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVS     71 - 140
REMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGL    141 - 210
VLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRK    211 - 280
VCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLV    281 - 350
YEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE    351 - 420
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAA    421 - 490
EVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG                                 491 - 531
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...