Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.20
PubTator Score 11.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.654 3.3e-07
Breast cancer 1.100 8.8e-05
breast carcinoma 1.700 7.1e-03
colon cancer 1.200 3.2e-02
dermatomyositis 1.300 2.3e-03
glioblastoma 1.600 7.6e-03
group 3 medulloblastoma 1.300 5.5e-04
lung adenocarcinoma 1.107 2.8e-04
lung cancer 1.700 2.1e-04
medulloblastoma, large-cell 1.400 5.0e-05
Multiple myeloma 1.949 6.5e-04
non-small cell lung cancer 1.146 2.6e-21
ovarian cancer 2.500 5.8e-05
pediatric high grade glioma 1.200 4.7e-05
Waldenstrons macroglobulinemia 1.214 1.9e-02

Gene RIF (6)

AA Sequence

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQ      1 - 70
HPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVS     71 - 140
REMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGL    141 - 210
VLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRK    211 - 280
VCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLV    281 - 350
YEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE    351 - 420
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAA    421 - 490
EVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG                                 491 - 531
//

Text Mined References (34)

PMID Year Title