Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.85
PubTator Score 11.99

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 2.61328911472533E-21
acute quadriplegic myopathy 1157 3.32929769513653E-7
lung cancer 4473 1.39049606288824E-5
pediatric high grade glioma 2712 4.67394820338197E-5
medulloblastoma, large-cell 6234 4.95574903774878E-5
ovarian cancer 8492 5.76555713244708E-5
Breast cancer 3099 8.80220587423525E-5
lung adenocarcinoma 2714 2.75209433760299E-4
group 3 medulloblastoma 2254 5.54757124927122E-4
Multiple myeloma 1328 6.4537246784778E-4
dermatomyositis 967 0.00231588802036633
breast carcinoma 1614 0.00706622840169042
glioblastoma 5572 0.00755339547334944
Waldenstrons macroglobulinemia 765 0.0191280884824041
colon cancer 1475 0.0318470774733674


  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.214 0.019
Multiple myeloma 1.949 0.001
glioblastoma 1.600 0.008
group 3 medulloblastoma 1.300 0.001
medulloblastoma, large-cell 1.400 0.000
acute quadriplegic myopathy 1.654 0.000
non-small cell lung cancer 1.146 0.000
colon cancer 1.200 0.032
lung cancer 1.800 0.000
breast carcinoma 1.700 0.007
pediatric high grade glioma 1.200 0.000
lung adenocarcinoma 1.107 0.000
ovarian cancer 2.500 0.000
Breast cancer 1.100 0.000
dermatomyositis 1.300 0.002


Accession P40227 A6NCD2 Q3KP28 Q75LP4 Q96S46 TCP-1-zeta
Symbols CCT6


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

23166591 Expression of HIV-1 Tat upregulates the abundance of chaperonin containing TCP1, subunit 6A (CCT6A) in the nucleoli of Jurkat T-cells
16211299 identified genes, which include Tcp20, may play important role in conferring radioresistance to oral squamous cell carcinoma and could be useful in identifying cases with more radioresistance

AA Sequence

EVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG                                 491 - 531

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.