Property Summary

NCBI Gene PubMed Count 118
PubMed Score 1632.28
PubTator Score 917.35

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

 OMIM Phenotype (1)

Gene RIF (93)

AA Sequence

MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG      1 - 70
EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTT     71 - 140
AHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTAS    141 - 210
ARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSD    211 - 280
TGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLS    281 - 350
QEG                                                                       351 - 353
//

Text Mined References (119)

PMID Year Title