Property Summary

NCBI Gene PubMed Count 114
Grant Count 290
R01 Count 136
Funding $32,848,204.37
PubMed Score 1582.87
PubTator Score 917.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P40225 A1L3Y0 B7ZLR8 B9EGA8 Q13020 Q15790 Q15791 Q15792
Symbols ML
TPO
MGDF
MKCSF
MPLLG
THCYT1

Gene

PDB

1V7M   1V7N  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
917 confirmatory 22 / 397 / 858 qHTS Assay for Identification of Small Molecule Agonists for Thrombopoietin (TPO) Signaling Pathway
918 confirmatory 122 / 1155 / 0 qHTS Assay for Identification of Small Molecule Antagonists for Thrombopoietin (TPO) Signaling Pathway

Gene RIF (89)

PMID Text
26175287 WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis.
26140605 Colorectal cancer tumor-initiating cells (TICs) expressing CD110, the thrombopoietin (TPO)-binding receptor, mediate liver metastasis. We show that TPO promotes metastasis of CD110+ TICs to the liver by activating lysine degradation.
25744030 observations suggest that NRP-1 is involved in megakaryocytopoiesis through complex formation with PDGFRs, and that NRP-1-PDGFR-complexes may contribute to effective cellular functions mediated by TPO and PDGF in megakaryocytic cells
25728497 decreased TPO levels or decreased bone marrow production of platelets may not be a cause of thrombocytopenia in chronic hepatitis C
25656774 The regulation of OCs by TPO highlights a novel therapeutic target for bone loss diseases and may be important to consider in the numerous hematologic disorders associated with alterations in TPO/c-mpl signaling
25485912 Endocytic AMR controls TPO expression through Janus kinase 2 (JAK2) and the acute phase response signal transducer and activator of transcription 3 (STAT3) in vivo and in vitro
25472766 TPO was greatly enhanced in HPT in comparison with ITP patients (958 +/- 659 and 11 +/- 27 pg/ml, p < 0.001). In the ITP group a reverse correlation was detected between TPO and glycocalicin (r = -0.373, p = 0.006).
25323752 Data suggest that elevated serum level of thrombopoietin may serve as unfavorable marker of stage of multiple myeloma.
24085763 An Arg->Cys substitution at residue 38 or residue 17 excluding the 21-AA signal peptide of the receptor binding domain was found in a family with aplastic anemia. Adding a 5th cysteine may disrupt normal disulfide bonding & receptor binding.
23403320 increased plasma thrombopoietin levels were associated with a favorable prognosis of bone marrow failure and could, therefore, represent a reliable marker for a benign subset of myelodysplastic syndrome.
More...

AA Sequence

MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG      1 - 70
EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTT     71 - 140
AHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTAS    141 - 210
ARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSD    211 - 280
TGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLS    281 - 350
QEG                                                                       351 - 353
//

Publication (115)

PMID Year Title
26175287 2015 Analyses of Genetic and Clinical Parameters for Screening Patients With Inherited Thrombocytopenia with Small or Normal-Sized Platelets.
26140605 2015 TPO-Induced Metabolic Reprogramming Drives Liver Metastasis of Colorectal Cancer CD110+ Tumor-Initiating Cells.
25744030 2015 Platelet-derived growth factor receptors form complexes with neuropilin-1 during megakaryocytic differentiation of thrombopoietin-dependent UT-7/TPO cells.
25728497 2015 Factors associated with the platelet count in patients with chronic hepatitis C.
25656774 2015 A novel role for thrombopoietin in regulating osteoclast development in humans and mice.
25485912 2015 The Ashwell-Morell receptor regulates hepatic thrombopoietin production via JAK2-STAT3 signaling.
25472766 2015 Relationships of mean platelet volume and plasma thrombopoietin with glycocalicin levels in thrombocytopenic patients.
25323752 2014 Does thrombopoiesis in multiple myeloma patients depend on the stage of the disease?
24085763 2013 Exome sequencing reveals a thrombopoietin ligand mutation in a Micronesian family with autosomal recessive aplastic anemia.
23403320 2013 Increased plasma thrombopoietin levels in patients with myelodysplastic syndrome: a reliable marker for a benign subset of bone marrow failure.
More...