Property Summary

NCBI Gene PubMed Count 34
PubMed Score 11.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 4.54426455942134E-19
pilocytic astrocytoma 3086 1.14963301814239E-6
psoriasis 6685 2.41843349078336E-4
ovarian cancer 8492 8.33157179639599E-4
astrocytoma 1493 0.0052723328354595
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0192386743548514

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 0.000
glioblastoma multiforme 1.100 0.000
astrocytoma 2.000 0.005
intraductal papillary-mucinous adenoma (... 1.100 0.019
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.200 0.001

Synonym

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
26527738 Silencing of alpha-taxilin expression leads to increased release of infectious hepatitis C virus particles.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
24690921 alpha-taxilin interacts with SNX4 and plays a role in the recycling pathway of TfnR.
23816704 alpha-taxilin plays an essential role for release of HBV-DNA containing particles.
22785156 Alpha-taxilin is localized on intracellular components in a syntaxin-independent manner and that the alpha-taxilin-containing intracellular components are associated with the microtubule cytoskeleton.
21551945 Increased alpha-taxilin protein expression is associated with the metastatic and invasive potential of renal cell cancer.
21042709 alpha-taxilin may be involved in cell proliferation of hepatocellular carcinoma(HCC), and its expression can be a marker of malignant potential of HCC.
19663695 analysis of a novel monoclonal antibody against interleukin-14alpha
19038581 IL-14a is important in the pathophysiology of Sjogren's disease
18645499 increases in IL-14 transcript levels may play a role in alloantibody formation after renal transplantation
More...

AA Sequence

MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRD      1 - 70
VSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDP     71 - 140
NTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQM    141 - 210
KLLQKKQSQLVQEKDHLRGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVT    211 - 280
LNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKE    281 - 350
AEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK    351 - 420
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSA    421 - 490
GGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA                  491 - 546
//

Text Mined References (47)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26527738 2016 Characterization of ?-taxilin as a novel factor controlling the release of hepatitis C virus.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25416956 2014 A proteome-scale map of the human interactome network.
24690921 2014 ?-Taxilin interacts with sorting nexin 4 and participates in the recycling pathway of transferrin receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23816704 2013 Identification of ?-taxilin as an essential factor for the life cycle of hepatitis B virus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22785156 2012 Interaction of ?-taxilin localized on intracellular components with the microtubule cytoskeleton.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...