Property Summary

NCBI Gene PubMed Count 34
PubMed Score 11.43
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 2.000 5.3e-03
Astrocytoma, Pilocytic 1.100 1.0e-06
glioblastoma multiforme 1.100 4.5e-19
intraductal papillary-mucinous adenoma (... 1.100 1.9e-02
ovarian cancer 1.200 8.3e-04
psoriasis -1.800 2.4e-04

Gene RIF (12)

AA Sequence

MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRD      1 - 70
VSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDP     71 - 140
NTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQM    141 - 210
KLLQKKQSQLVQEKDHLRGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVT    211 - 280
LNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKE    281 - 350
AEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK    351 - 420
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSA    421 - 490
GGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA                  491 - 546
//

Text Mined References (47)

PMID Year Title