Property Summary

NCBI Gene PubMed Count 34
Grant Count 3
Funding $193,476.67
PubMed Score 11.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 0.000
glioblastoma multiforme 1.100 0.000
astrocytoma 2.000 0.005
intraductal papillary-mucinous adenoma (... 1.100 0.019
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.200 0.001

Gene RIF (12)

PMID Text
26527738 Silencing of alpha-taxilin expression leads to increased release of infectious hepatitis C virus particles.
25940130 intrathyroidal production of IL-14 and IL-16 associated with the pathogenesis of autoimmune thyroid disease
24690921 alpha-taxilin interacts with SNX4 and plays a role in the recycling pathway of TfnR.
23816704 alpha-taxilin plays an essential role for release of HBV-DNA containing particles.
22785156 Alpha-taxilin is localized on intracellular components in a syntaxin-independent manner and that the alpha-taxilin-containing intracellular components are associated with the microtubule cytoskeleton.
21551945 Increased alpha-taxilin protein expression is associated with the metastatic and invasive potential of renal cell cancer.
21042709 alpha-taxilin may be involved in cell proliferation of hepatocellular carcinoma(HCC), and its expression can be a marker of malignant potential of HCC.
19663695 analysis of a novel monoclonal antibody against interleukin-14alpha
19038581 IL-14a is important in the pathophysiology of Sjogren's disease
18645499 increases in IL-14 transcript levels may play a role in alloantibody formation after renal transplantation
More...

AA Sequence

MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRD      1 - 70
VSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDP     71 - 140
NTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQM    141 - 210
KLLQKKQSQLVQEKDHLRGEHSKAVLARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVT    211 - 280
LNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKE    281 - 350
AEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK    351 - 420
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSA    421 - 490
GGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA                  491 - 546
//

Text Mined References (47)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26527738 2016 Characterization of ?-taxilin as a novel factor controlling the release of hepatitis C virus.
25940130 2015 IL-14 and IL-16 are expressed in the thyroid of patients with either Graves' disease or Hashimoto's thyroiditis.
25416956 2014 A proteome-scale map of the human interactome network.
24690921 2014 ?-Taxilin interacts with sorting nexin 4 and participates in the recycling pathway of transferrin receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23816704 2013 Identification of ?-taxilin as an essential factor for the life cycle of hepatitis B virus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22785156 2012 Interaction of ?-taxilin localized on intracellular components with the microtubule cytoskeleton.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...