Property Summary

NCBI Gene PubMed Count 85
Grant Count 26
R01 Count 12
Funding $6,060,768.91
PubMed Score 244.91
PubTator Score 303.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -6.925 0.000
primary pancreatic ductal adenocarcinoma 4.991 0.001
non-small cell lung cancer -1.115 0.002
intraductal papillary-mucinous neoplasm ... 4.100 0.017
colon cancer 1.300 0.020
lung cancer -6.200 0.000
active Crohn's disease 1.725 0.031
active ulcerative colitis 2.658 0.031
pancreatic cancer 4.800 0.002
interstitial cystitis 4.400 0.000
primary Sjogren syndrome 1.200 0.016
invasive ductal carcinoma 1.757 0.022
nasopharyngeal carcinoma -3.900 0.000
lung carcinoma -5.200 0.000
breast carcinoma 2.700 0.000
Breast cancer 2.500 0.001
ductal carcinoma in situ 5.600 0.000
ovarian cancer -1.200 0.000

Gene RIF (54)

PMID Text
26974538 Biliary CEACAM6 can identify patients with extrahepatic cholangiocarcinoma with a high degree of sensitivity and should be investigated further as a potential screening tool.
26673628 show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6
26483485 Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another.
26374831 CEACAM6 protein and mRNA were increased ~4-fold in lungs from infants with chronic lung disease as compared with controls.
26271985 Data show that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) and forkhead box P3 (FOXP3) are associated with the malignant degree of pancreatic cancer.
25872647 vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer
25703140 Data indicate that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes angiogenesis in gastric cancer via focal adhesion kinase FAK signaling.
25409014 Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition.
25398131 CEACAM6 increased the levels of phosphorylated AKT, which is involved in the progression of a variety of human tumors.
25299082 CEACAM6 may be a valuable biomarker screening for gastric tumor and novel predictor for patients in advanced stages of gastric cancer
More...

AA Sequence

MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDA    141 - 210
GSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQS    211 - 280
TQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI          281 - 344
//

Publication (89)

PMID Year Title
26974538 2016 The Role of Biliary Carcinoembryonic Antigen-Related Cellular Adhesion Molecule 6 (CEACAM6) as a Biomarker in Cholangiocarcinoma.
26673628 2015 Interleukin-6 trans-signaling increases the expression of carcinoembryonic antigen-related cell adhesion molecules 5 and 6 in colorectal cancer cells.
26483485 2015 Diverse oligomeric states of CEACAM IgV domains.
26374831 2015 Expression of Carcinoembryonic Cell Adhesion Molecule 6 and Alveolar Epithelial Cell Markers in Lungs of Human Infants with Chronic Lung Disease.
26271985 2015 [The effects of CEACAM6 and FOXP3 on tumor infiltrating lymphocytes and prognosis in patients with pancreatic cancer].
25872647 2015 Recombinant Salmonella-based CEACAM6 and 4-1BBL vaccine enhances T-cell immunity and inhibits the development of colorectal cancer in rats: In vivo effects of vaccine containing 4-1BBL and CEACAM6.
25703140 2015 CEACAM6 promotes tumor angiogenesis and vasculogenic mimicry in gastric cancer via FAK signaling.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25409014 2014 Carcinoembryonic antigen-related cell adhesion molecules (CEACAM) 1, 5 and 6 as biomarkers in pancreatic cancer.
25398131 2014 CEACAM6 promotes gastric cancer invasion and metastasis by inducing epithelial-mesenchymal transition via PI3K/AKT signaling pathway.
More...