Property Summary

NCBI Gene PubMed Count 95
PubMed Score 255.08
PubTator Score 303.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.725 3.1e-02
active ulcerative colitis 2.658 3.1e-02
Breast cancer 2.500 6.8e-04
breast carcinoma 2.700 5.8e-23
colon cancer 1.300 2.0e-02
ductal carcinoma in situ 5.600 8.5e-05
interstitial cystitis 3.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 4.100 1.7e-02
invasive ductal carcinoma 1.757 2.2e-02
lung cancer -3.200 7.7e-04
lung carcinoma -5.200 5.5e-39
nasopharyngeal carcinoma -3.600 5.1e-08
non-small cell lung cancer -1.039 9.7e-03
osteosarcoma -6.903 1.0e-10
ovarian cancer -1.200 4.4e-04
pancreatic cancer 4.000 3.5e-06
pancreatic ductal adenocarcinoma liver m... 3.920 2.2e-02
primary Sjogren syndrome 1.200 1.6e-02
psoriasis -1.400 3.9e-04

Gene RIF (64)

AA Sequence

MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDA    141 - 210
GSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQS    211 - 280
TQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI          281 - 344
//

Text Mined References (99)

PMID Year Title