1. Home
  2. Targets
  3. Carcinoembryonic antigen-related cell adhesion molecule 3

Tbio Carcinoembryonic antigen-related cell adhesion molecule 3

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.

This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013]

 Comments

Property Summary

NCBI Gene PubMed Count 31
Grant Count 3
Funding $35,721.66
PubMed Score 15.41
PubTator Score 8281.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Disease Z-score Confidence
Gonorrhea 14 3.446 1.7
non primary Sjogren syndrome sicca 840
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.364 0.000
non primary Sjogren syndrome sicca 1.100 0.015
psoriasis 1.900 0.000

Synonym

Accession P40198 G5E978 Q3KPH9
Symbols CEA
CGM1
W264
W282
CD66D

Gene

CEACAM3

 Grant Application (3)

 GO Component (1)

 Compartment GO Term (5)

 GWAS Trait (1)

Pathway (6)

 UniProt Keyword (11)

See all...

Gene RIF (21)

PMID Text
26556959 Demonstrated the CEACAM3 specificity and a perioperative trend of circulating tumor cells which is coherent with the clinical/pathological considerations in colorectal cancer.
26162539 COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM
23630956 A failure of CEACAM3-mediated innate immune detection might be linked to the ability of gonococci to cause disseminated infections.
22948154 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact
22469950 CEACAM3 promotes opsonin-independent phagocytosis of CEACAM-binding bacteria. CEACAM3 is the main driver for this process on human granulocytes.
22382453 The higher expression of CD44v6, integrin-beta1, CA199, and CEA are closely related to the progression and metastasis of pancreatic cancer.[CA199, CD44v6]
22064717 The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils.
21216968 the ability of CEACAM3 to coordinate signaling events that not only mediate bacterial uptake, but also trigger the killing of internalized pathogens.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373053 the prognostic value of preoperative serum carbohydrate antigen19-9, carcinoembryonic antigen, and carbohydrate antigen 125 for overall survival in patients with colorectal cancer was studied
More...

AA Sequence 

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM    141 - 210
SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS                                211 - 252
//

Text Mined References (33)

PMID Year Title
26556959 2015 The Trend of CEACAM3 Blood Expression as Number Index of the CTCs in the Colorectal Cancer Perioperative Course.
26162539 2015 Improved tumour marker sensitivity in detecting colorectal liver metastases by combined type IV collagen and CEA measurement.
23630956 2013 Innate recognition by neutrophil granulocytes differs between Neisseria gonorrhoeae strains causing local or disseminating infections.
22948154 2012 Grb14 is a negative regulator of CEACAM3-mediated phagocytosis of pathogenic bacteria.
22469950 2012 HemITAM signaling by CEACAM3, a human granulocyte receptor recognizing bacterial pathogens.
22382453 2012 The efficacy evaluation of cryosurgery in pancreatic cancer patients with the expression of CD44v6, integrin-?1, CA199, and CEA.
22064717 2012 Defining the roles of human carcinoembryonic antigen-related cellular adhesion molecules during neutrophil responses to Neisseria gonorrhoeae.
21216968 2011 Phosphatidylinositol 3'-kinase activity is critical for initiating the oxidative burst and bacterial destruction during CEACAM3-mediated phagocytosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373053 2011 Preoperative serum carbohydrate antigen 125 level is an independent negative prognostic marker for overall survival in colorectal cancer.
More...