Property Summary

NCBI Gene PubMed Count 37
PubMed Score 15.86
PubTator Score 8281.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 7.8e-17
osteosarcoma 7950 2.5e-03
non primary Sjogren syndrome sicca 891 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gonorrhea 13 3.309 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma -1.477 2.5e-03
psoriasis 1.900 7.8e-17

Gene RIF (27)

AA Sequence

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM    141 - 210
SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS                                211 - 252
//

Text Mined References (39)

PMID Year Title