Property Summary

Ligand Count 3
NCBI Gene PubMed Count 226
PubMed Score 55.35
PubTator Score 439.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Adenoma 167 3.093 1.5
Cancer 2499 3.025 1.5

Expression

  Differential Expression (38)

Disease log2 FC p
Rheumatoid arthritis 2.200 9.8e-03
active Crohn's disease 1.242 1.6e-02
acute quadriplegic myopathy 1.148 4.5e-04
adult high grade glioma 1.100 1.5e-02
aldosterone-producing adenoma -1.219 3.9e-02
astrocytic glioma 1.200 1.2e-02
Astrocytoma, Pilocytic 1.200 9.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.466 2.3e-03
colon cancer -1.600 3.2e-05
Common variable immunodeficiency -1.436 4.3e-03
dermatomyositis 1.300 4.3e-03
Down syndrome 1.200 9.3e-04
Duchenne muscular dystrophy 1.171 2.6e-05
ductal carcinoma in situ -1.300 1.3e-02
ependymoma 1.100 1.9e-02
Gaucher disease type 1 -2.500 1.2e-02
glioblastoma 1.300 8.8e-03
group 3 medulloblastoma -1.900 1.6e-03
intraductal papillary-mucinous carcinoma... -1.100 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.5e-02
invasive ductal carcinoma -1.100 3.6e-02
juvenile dermatomyositis 1.393 1.9e-10
lung cancer -2.800 1.9e-05
lung carcinoma -1.300 4.7e-19
medulloblastoma, large-cell -1.900 7.6e-04
mucosa-associated lymphoid tissue lympho... 1.201 2.4e-02
Multiple myeloma 1.690 1.7e-03
non-small cell lung cancer -1.207 5.2e-08
oligodendroglioma 1.100 3.0e-02
osteosarcoma 1.043 4.8e-03
ovarian cancer -2.600 5.7e-10
pancreatic ductal adenocarcinoma liver m... -2.048 1.8e-02
Pick disease 1.100 8.5e-04
Polycystic ovary syndrome -1.514 2.5e-02
progressive supranuclear palsy -2.000 3.0e-03
psoriasis -1.300 1.8e-02
spina bifida -1.066 2.9e-02
ulcerative colitis 1.500 8.6e-07

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (165)

AA Sequence

MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTN      1 - 70
HFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGK     71 - 140
KMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSD    141 - 210
HINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTAST    211 - 280
RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLV    281 - 350
WKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD    351 - 420
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESK    421 - 490
CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRT    491 - 560
IIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFL    561 - 630
LTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEAND    631 - 700
KKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQ    701 - 770
VPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV    771 - 840
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEGMPKSYLPQTV    841 - 910
RQGGYMPQ                                                                  911 - 918
//

Text Mined References (236)

PMID Year Title