Property Summary

NCBI Gene PubMed Count 217
Grant Count 4
R01 Count 3
Funding $432,894.6
PubMed Score 50.51
PubTator Score 439.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
Adenoma 165 3.018 1.5
Angiofollicular lymph node hyperplasia 3
Animal Mammary Neoplasms 136
Carcinoma 2,147 1.0
Colorectal Neoplasms 217
Common variable immunodeficiency 72
Down syndrome 548
Duchenne muscular dystrophy 602
Gaucher disease type 1 171
Hypersensitivity 63
Infarction, Middle Cerebral Artery 25
Juvenile rheumatoid arthritis 104
Mammary Neoplasms, Experimental 150
Multiple myeloma 1,327
Myocardial Ischemia 169
Pick disease 1,893
Pneumonia 133
Polycystic Ovary Syndrome 332
Reperfusion Injury 84
Rheumatoid Arthritis 1,160 5.0
Thrombocytopenic disorder 3
active Crohn's disease 918
acute quadriplegic myopathy 1,157
adult high grade glioma 2,148
aldosterone-producing adenoma 664
astrocytic glioma 2,241
autosomal dominant Emery-Dreifuss muscul... 499 
colon cancer 1,475
dermatomyositis 933
ductal carcinoma in situ 1,745
ependymoma 2,514
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic ductal adenocarcinoma liver m... 1,795 
pilocytic astrocytoma 3,086
progressive supranuclear palsy 674
psoriasis 6,685
spina bifida 1,064
ulcerative colitis 2,087

Expression

Synonym

Accession P40189 A0N0L4 Q5FC04 Q9UQ41 IL-6 receptor subunit beta
Symbols CD130
GP130
CDW130
IL-6RB

Gene

PDB

1BJ8   1BQU   1I1R   1N2Q   1P9M   1PVH   3L5H   3L5I   3L5J  

Gene RIF (157)

PMID Text
26809098 In the present study, we analyze the role of a unique cysteine residue (Cys-628) within this C-terminus, which is contained neither in the membrane-bound gp130 nor in the two other sgp130 forms.
26699882 High serum GP130 levels were associated with Chronic Spontaneous Urticaria.
26589480 pulmonary exposure to MWCNT can manifest as a reduced epithelial barrier and activator of vascular gp130-associated transsignaling that may promote susceptibility to cardiovascular derangements
26525581 PECs exhibited higher proliferation in response to IL-6/sIL-6R co-treatment compared with TECs in HCC via the up-regulation of gp130 /JAK2/STAT3.
26266960 Increased soluble gp130 in older patients may inhibit IL-6 trans-signaling, impair barrier function, and decrease S100A8/ S100A9 production in elderly chronic rhinosinusitis patients with asthma and nasal polyps.
26191141 Diabetic rats show an increase in the contractions of distal colon partly via the IL-6-IL-6 receptor pathway.
26188635 Mutations leading to constitutive active gp130/JAK1/STAT3 pathway.
25966666 Mesenchymal Stem Cells Isolated From Human Gliomas Increase Proliferation and Maintain Stemness of Glioma Stem Cells Through the IL-6/gp130/STAT3 Pathway.
25910182 Elevated levels of sIL6R were associated with the risk of myocardial infarction and serum levels of sgp130 seemed to modify this association.
25747354 GP130/STAT3 pathway is activated in NAFLD and can worsen insulin resistance while protecting against other lipotoxic mechanisms of disease pathogenesis.
More...

AA Sequence

MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTN      1 - 70
HFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGK     71 - 140
KMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSD    141 - 210
HINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTAST    211 - 280
RSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLV    281 - 350
WKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD    351 - 420
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESK    421 - 490
CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRT    491 - 560
IIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFL    561 - 630
LTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEAND    631 - 700
KKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQ    701 - 770
VPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV    771 - 840
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEGMPKSYLPQTV    841 - 910
RQGGYMPQ                                                                  911 - 918
//

Text Mined References (227)

PMID Year Title
26809098 2016 A soluble form of the interleukin-6 family signal transducer gp130 is dimerized via a C-terminal disulfide bridge resulting from alternative mRNA splicing.
26699882 2015 IL-6 Transsignaling in Patients with Chronic Spontaneous Urticaria.
26589480 2016 Pulmonary instillation of MWCNT increases lung permeability, decreases gp130 expression in the lungs, and initiates cardiovascular IL-6 transsignaling.
26525581 2015 Higher proliferation of peritumoral endothelial cells to IL-6/sIL-6R than tumoral endothelial cells in hepatocellular carcinoma.
26266960 2015 Age-related increased prevalence of asthma and nasal polyps in chronic rhinosinusitis and its association with altered IL-6 trans-signaling.
26191141 2015 Interleukin-6 (IL-6) mediated the increased contraction of distal colon in streptozotocin-induced diabetes in rats via IL-6 receptor pathway.
26188635 2015 Mutations leading to constitutive active gp130/JAK1/STAT3 pathway.
25966666 2015 Mesenchymal Stem Cells Isolated From Human Gliomas Increase Proliferation and Maintain Stemness of Glioma Stem Cells Through the IL-6/gp130/STAT3 Pathway.
25910182 2015 Circulating levels of interleukin 6 soluble receptor and its natural antagonist, sgp130, and the risk of myocardial infarction.
25747354 2015 Activation of the GP130-STAT3 axis and its potential implications in nonalcoholic fatty liver disease.
More...