Property Summary

NCBI Gene PubMed Count 39
PubMed Score 108.34
PubTator Score 58.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 5.58066433824282E-22
group 3 medulloblastoma 2254 1.10253375095484E-5
atypical teratoid/rhabdoid tumor 1095 1.58312246775185E-5
medulloblastoma, large-cell 6234 2.22147015021918E-5
primitive neuroectodermal tumor 3031 0.00224090073794519
pilocytic astrocytoma 3086 0.00309795394140271
astrocytic glioma 2241 0.0307485504323648
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 2.300 0.031
group 3 medulloblastoma -2.200 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.002
pilocytic astrocytoma -1.100 0.003
psoriasis -1.800 0.000

Synonym

Accession P40145
Symbols AC8
ADCY3
HBAC1

Gene

PANTHER Protein Class (3)

  Ortholog (9)

Gene RIF (25)

PMID Text
25403481 ADCY8 is required for the physiological activation of glucose-induced signalling pathways in beta cells, for glucose tolerance and for hypothalamic adaptation to a high-fat diet via regulation of islet insulin secretion.
24677629 ADCY8 is integral for long-term potentiation and synaptic plasticity and is implicated in fear-related learning and memory.
23278386 Polymorphisms ADCY8 are associated with an alcohol-dependent phenotype in females, which is distinguished by comorbid signs of depression.
23200849 The adenylate cyclase 8 plays a major role in cAMP production.
22494970 Orai1 and AC8 binding mediates dynamic interplay between Ca2+ and cAMP signaling
21046358 cAMP-mediated pathways are modelled by glucose, and downregulation of the calcium-sensitive ADCY8 plays a central role herein, including signalling via the GLP1R.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20675917 Ca2+ entry increase was accompanied by red cell aggregation rise, while adenylyl cyclase-cAMP system stimulation led to red cell deformability increase and its aggregation lowered.
20410303 Data reveal that an association of the Ca(2+)-stimulable AC8 with AKAP79/150 that limits the sensitivity of AC8 to intracellular Ca(2+) events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGSGSGGSGKASD      1 - 70
PAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSD     71 - 140
FFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDP    141 - 210
LKGILLGFFTGIEVVICALVVVRKDTTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFA    211 - 280
TYSMLPLPLTWAILAGLGTSLLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAF    281 - 350
LETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV    351 - 420
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMI    421 - 490
KTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLN    491 - 560
GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFD    561 - 630
NIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSL    631 - 700
EHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLI    701 - 770
LRKTCCWINETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG    771 - 840
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEVSLLLMAMFLL    841 - 910
AVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDA    911 - 980
VGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK    981 - 1050
QQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASR   1051 - 1120
MDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQY   1121 - 1190
SLAAVVLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP            1191 - 1251
//

Text Mined References (41)

PMID Year Title
25403481 2015 Multilevel control of glucose homeostasis by adenylyl cyclase 8.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
23278386 2013 Genetic markers of comorbid depression and alcoholism in women.
23200849 2013 G?(h)/transglutaminase-2 activity is required for maximal activation of adenylylcyclase 8 in human and rat glioma cells.
22494970 2012 Direct binding between Orai1 and AC8 mediates dynamic interplay between Ca2+ and cAMP signaling.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21046358 2011 Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20675917 2010 Crosstalk between adenylyl cyclase signaling pathway and Ca2+ regulatory mechanism under red blood cell microrheological changes.
More...