Property Summary

NCBI Gene PubMed Count 39
Grant Count 46
R01 Count 34
Funding $3,029,806.02
PubMed Score 108.34
PubTator Score 58.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 2.300 0.031
group 3 medulloblastoma -2.200 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.002
pilocytic astrocytoma -1.100 0.003
psoriasis -1.800 0.000

Gene RIF (25)

PMID Text
25403481 ADCY8 is required for the physiological activation of glucose-induced signalling pathways in beta cells, for glucose tolerance and for hypothalamic adaptation to a high-fat diet via regulation of islet insulin secretion.
24677629 ADCY8 is integral for long-term potentiation and synaptic plasticity and is implicated in fear-related learning and memory.
23278386 Polymorphisms ADCY8 are associated with an alcohol-dependent phenotype in females, which is distinguished by comorbid signs of depression.
23200849 The adenylate cyclase 8 plays a major role in cAMP production.
22494970 Orai1 and AC8 binding mediates dynamic interplay between Ca2+ and cAMP signaling
21046358 cAMP-mediated pathways are modelled by glucose, and downregulation of the calcium-sensitive ADCY8 plays a central role herein, including signalling via the GLP1R.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20675917 Ca2+ entry increase was accompanied by red cell aggregation rise, while adenylyl cyclase-cAMP system stimulation led to red cell deformability increase and its aggregation lowered.
20410303 Data reveal that an association of the Ca(2+)-stimulable AC8 with AKAP79/150 that limits the sensitivity of AC8 to intracellular Ca(2+) events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGSGSGGSGKASD      1 - 70
PAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASGSGGGGDLGFLHLDCAPSNSD     71 - 140
FFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDP    141 - 210
LKGILLGFFTGIEVVICALVVVRKDTTSHTYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFA    211 - 280
TYSMLPLPLTWAILAGLGTSLLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAF    281 - 350
LETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV    351 - 420
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMI    421 - 490
KTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLN    491 - 560
GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFD    561 - 630
NIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSL    631 - 700
EHKYSQMRDEVFKSNLVCAFIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLI    701 - 770
LRKTCCWINETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG    771 - 840
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEVSLLLMAMFLL    841 - 910
AVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDA    911 - 980
VGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEK    981 - 1050
QQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASR   1051 - 1120
MDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQY   1121 - 1190
SLAAVVLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP            1191 - 1251
//

Text Mined References (41)

PMID Year Title
25403481 2015 Multilevel control of glucose homeostasis by adenylyl cyclase 8.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
23278386 2013 Genetic markers of comorbid depression and alcoholism in women.
23200849 2013 G?(h)/transglutaminase-2 activity is required for maximal activation of adenylylcyclase 8 in human and rat glioma cells.
22494970 2012 Direct binding between Orai1 and AC8 mediates dynamic interplay between Ca2+ and cAMP signaling.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21046358 2011 Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20675917 2010 Crosstalk between adenylyl cyclase signaling pathway and Ca2+ regulatory mechanism under red blood cell microrheological changes.
More...