Property Summary

NCBI Gene PubMed Count 53
PubMed Score 161.60
PubTator Score 160.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -2.000 1.5e-32
cutaneous lupus erythematosus -4.800 3.6e-04
ependymoma 1.100 6.6e-03
group 3 medulloblastoma 2.700 3.6e-03
non primary Sjogren syndrome sicca -1.100 1.7e-02
psoriasis 1.100 2.6e-02

 CSPA Cell Line (2)

Protein-protein Interaction (7)

Gene RIF (21)

AA Sequence

MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRP      1 - 70
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ     71 - 140
FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFS    141 - 210
HQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFS    211 - 280
SWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA    281 - 350
LEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQE    351 - 420
LAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLL    421 - 490
AFLQYRRLRKGYTPLMETHLSSKRYTEEA                                             491 - 519
//

Text Mined References (53)

PMID Year Title