Property Summary

NCBI Gene PubMed Count 51
Grant Count 279
R01 Count 150
Funding $46,698,740.44
PubMed Score 155.53
PubTator Score 160.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -4.800 0.000
psoriasis 1.500 0.000
posterior fossa group A ependymoma 1.700 0.000
group 3 medulloblastoma 2.700 0.004
non primary Sjogren syndrome sicca -1.100 0.017
Breast cancer -2.000 0.000

Synonym

Accession P40126 Q09GT4 DCT
Symbols TRP-2
TYRP2

Gene

DCT

PANTHER Protein Class (2)

PDB

4HX1  

Gene RIF (19)

PMID Text
25346513 The effect of DCT on UVR DNA damage responses and survival pathways in melanocytes was examined by knockdown experiments using melanoma cells, neonatal melanoblasts in monoculture and in co-culture with keratinocytes.
24709887 Report dopachrome tautomerase expression in mealanocytic tumors.
22988252 Data suggest that macrophage migration inhibitory factor (MIF) and d-dopachrome tautomerase (d-DT) act cooperatively to inhibit steady-state phosphorylation and activation of AMPK in LKB1 wild type and LKB1 mutant non-small cell lung carcinomas cells.
22898827 The results suggested that the miRNAs may be involved in MITF regulation of TYR, TYRP1 and TYRP2, which provides a new clue for understanding the role of miRNAs in melanocyte dysfunctional disease.
20520707 human TRP2 counteracts apoptotic cell death induction, possibly by means of its L-dopachrome tautomerase activity, and negatively affects the p53 pathway
20356546 Trp2 SNP2 allele is a risk factor for the development and severity of degenerative disc disease in a Chinese Han population.
20356546 Observational study of gene-disease association. (HuGE Navigator)
20221248 Observational study of gene-disease association. (HuGE Navigator)
19855129 Expression profiling demonstrated that the DCT-expressing cell population expressed adrenergic and muscarinic receptors and displayed transcriptional profiles distinct from dermal melanocytes
19284502 tyrosinase-related protein 2 (TRP-2) transcript is not detected in the peripheral blood mononuclear cells (PBMC) of vitiligo patients
More...

AA Sequence

MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRP      1 - 70
WSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQ     71 - 140
FLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFS    141 - 210
HQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFS    211 - 280
SWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA    281 - 350
LEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQE    351 - 420
LAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLL    421 - 490
AFLQYRRLRKGYTPLMETHLSSKRYTEEA                                             491 - 519
//

Text Mined References (51)

PMID Year Title
25346513 2014 DCT protects human melanocytic cells from UVR and ROS damage and increases cell viability.
24709887 2014 Value of dopachrome tautomerase detection in the assessment of melanocytic tumors.
22988252 2012 Negative regulation of AMP-activated protein kinase (AMPK) activity by macrophage migration inhibitory factor (MIF) family members in non-small cell lung carcinomas.
22898827 2012 The changes of microRNA expression profiles and tyrosinase related proteins in MITF knocked down melanocytes.
20520707 2010 HIF-1 antagonizes p53-mediated apoptosis through a secreted neuronal tyrosinase.
20356546 2010 [Association study of Trp2 allele polymorphism with degenerative disc disease in a Chinese Han nationality].
20221248 2010 Association of the OCA2 polymorphism His615Arg with melanin content in east Asian populations: further evidence of convergent evolution of skin pigmentation.
19855129 2009 Melanocyte-like cells in the heart and pulmonary veins contribute to atrial arrhythmia triggers.
19284502 2009 Absence of tyrosinase-related protein-2/dopachrome tautomerase transcripts in PBMCs from vitiligo patients.
18674612 2008 TRP-2 expression protects HEK cells from dopamine- and hydroquinone-induced toxicity.
More...