Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.39
PubTator Score 47.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 6.5e-03
astrocytic glioma -2.100 1.5e-02
Astrocytoma, Pilocytic -2.300 1.0e-06
atypical teratoid / rhabdoid tumor -1.200 4.9e-03
Breast cancer 3.700 2.2e-02
chronic rhinosinusitis -1.153 6.5e-03
colon cancer -2.100 1.4e-02
ductal carcinoma in situ -1.500 7.8e-03
ependymoma -2.400 4.4e-03
glioblastoma -2.100 4.6e-08
group 3 medulloblastoma -2.500 3.3e-03
interstitial cystitis -1.100 3.7e-02
intraductal papillary-mucinous adenoma (... -1.500 3.0e-03
intraductal papillary-mucinous carcinoma... -1.300 2.8e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.8e-02
lung cancer 1.500 3.1e-03
malignant mesothelioma -1.900 1.7e-07
medulloblastoma, large-cell -3.100 4.9e-04
oligodendroglioma -1.700 3.0e-02
ovarian cancer -1.200 5.3e-04
Parkinson's disease -1.400 1.9e-02
Pick disease -1.500 3.2e-02
primitive neuroectodermal tumor -2.100 1.3e-03

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGD      1 - 70
VETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESI     71 - 140
PALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWS    141 - 210
KTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHV    211 - 280
TDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETEL    281 - 350
KQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH    351 - 420
IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPIPEQFKTAWDGSKLITEPAEIMA                 421 - 477
//

Text Mined References (20)

PMID Year Title