Property Summary

NCBI Gene PubMed Count 44
PubMed Score 25.49
PubTator Score 80.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.400 2.7e-03
Astrocytoma, Pilocytic 1.200 3.3e-05
breast carcinoma 1.200 7.3e-05
cystic fibrosis 1.127 3.1e-05
ductal carcinoma in situ 1.300 1.9e-04
glioblastoma 1.500 1.7e-05
interstitial cystitis -1.800 7.8e-05
intraductal papillary-mucinous adenoma (... 1.800 3.3e-03
intraductal papillary-mucinous carcinoma... 1.100 4.9e-02
invasive ductal carcinoma 1.962 1.7e-05
lung cancer -1.200 8.2e-03
lung carcinoma -2.300 4.8e-23
malignant mesothelioma -2.600 1.2e-07
osteosarcoma -1.360 2.8e-02
ovarian cancer 2.100 4.0e-04
pancreatic cancer 1.700 1.4e-05
primary pancreatic ductal adenocarcinoma 2.190 3.1e-03
subependymal giant cell astrocytoma 2.357 2.1e-02
tuberculosis 1.300 6.5e-07

Gene RIF (26)

AA Sequence

MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS      1 - 70
RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY     71 - 140
QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI    141 - 210
VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD    211 - 280
DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK      281 - 348
//

Text Mined References (50)

PMID Year Title