Property Summary

NCBI Gene PubMed Count 43
Grant Count 48
R01 Count 36
Funding $5,218,985.99
PubMed Score 22.37
PubTator Score 80.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
26757732 The composite biomarker, CAPG and GIPC1 in primary breast tumors, predicted disease outcomes and benefit from zoledronate and may facilitate patient selection for adjuvant bisphosphonate treatment.
26466680 On the basis of these results, we propose a model in which dynamic vimentin filaments target CARMIL2 to critical membrane-associated locations, where CARMIL2 regulates CP, and thus actin assembly, to create cell protrusions
24804218 A single nucleotide polymorphism rs6886 inside the CapG gene was identified, affecting a CapG phosphorylation site and thus potentially modifying CapG function.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of capping protein gelsolin-like (CAPG) expression by HIV-1 Vpr in Vpr transduced macrophages
23782053 CapG was up-regulated in the tumor tissues of patients with lymph node metastasis (LNM), whereas it showed an equivalent expression level between non-tumor and tumor tissues of patients without LNM.
23085225 CapG is involved in the process of metastasis by promoting the invasiveness of tumor cells.
22190510 Expression of CapG, gelsolin, and P-gp was found to be associated with an increased risk of death from non-small cell lung cancer.
22155129 CapG was identified as a novel candidate biomarker to predict response to gemcitabine treatment and survival in cholangiocarcinoma.
21908955 These results suggest that overexpression of CapG may be associated with progression of lung adenocarcinoma.
21768101 strong down-regulation of MCK activity contributes to F-actin instability and induces post-translational modification of alphaB-crystallin and desmin
More...

AA Sequence

MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS      1 - 70
RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY     71 - 140
QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI    141 - 210
VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD    211 - 280
DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK      281 - 348
//

Text Mined References (49)

PMID Year Title
26757732 2016 CAPG and GIPC1: Breast Cancer Biomarkers for Bone Metastasis Development and Treatment.
26634544 2015 Influence of suppression of CapG gene expression by siRNA on the growth and metastasis of human prostate cancer cells.
26466680 2015 CARMIL2 is a novel molecular connection between vimentin and actin essential for cell migration and invadopodia formation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24804218 2014 Macrophage capping protein CapG is a putative oncogene involved in migration and invasiveness in ovarian carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24236012 2013 L-plastin nanobodies perturb matrix degradation, podosome formation, stability and lifetime in THP-1 macrophages.
23782053 2013 Laser microdissection and two-dimensional difference gel electrophoresis reveal the role of a novel macrophage-capping protein in lymph node metastasis in gastric cancer.
More...