Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.41
PubTator Score 7.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.7e-04
atypical teratoid / rhabdoid tumor 1.300 3.0e-04
glioblastoma 1.200 2.9e-05
group 3 medulloblastoma 1.200 3.8e-03
lung cancer 1.100 1.9e-02
non-small cell lung cancer 1.997 1.7e-23
ovarian cancer 2.600 1.4e-05

Gene RIF (1)

AA Sequence

MARVAWGLLWLLLGSAGAQYEKYSFRGFPPEDLMPLAAAYGHALEQYEGESWRESARYLEAALRLHRLLR      1 - 70
DSEAFCHANCSGPAPAAKPDPDGGRADEWACELRLFGRVLERAACLRRCKRTLPAFQVPYPPRQLLRDFQ     71 - 140
SRLPYQYLHYALFKANRLEKAVAAAYTFLQRNPKHELTAKYLNYYQGMLDVADESLTDLEAQPYEAVFLR    141 - 210
AVKLYNSGDFRSSTEDMERALSEYLAVFARCLAGCEGAHEQVDFKDFYPAIADLFAESLQCKVDCEANLT    211 - 280
PNVGGYFVDKFVATMYHYLQFAYYKLNDVRQAARSAASYMLFDPKDSVMQQNLVYYRFHRARWGLEEEDF    281 - 350
QPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQE    351 - 420
PDAKGDEAEAEPEPELA                                                         421 - 437
//

Text Mined References (11)

PMID Year Title