Property Summary

NCBI Gene PubMed Count 169
Grant Count 1,088
R01 Count 582
Funding $159,963,368.34
PubMed Score 2301.53
PubTator Score 927.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.280 0.000
cystic fibrosis 1.183 0.000
medulloblastoma, large-cell 1.800 0.012

Synonym

Accession P39905 B7WPK7 O95448 O95449 O95986 Q6FH33 Q96L44 Q9UD32 Q9UD33 Q9UMV2 Q9UP67 Q9UP97 hGDNF
Symbols ATF
ATF1
ATF2
HSCR3
HFB1-GDNF

Gene

PDB

2V5E   3FUB   4UX8  

Gene RIF (130)

PMID Text
26549420 These results demonstrate the pivotal role of GDNF as well as the PI3K/Akt pathway, but not the MAPK pathway, in the prevention of diabetesinduced neuronal apoptosis in the hippocampus.
26096985 The GDNF polymorphism rs3096140 is associated with Tourette syndrome.
25913759 Osteogenic features of MSCs from ossification of yellow ligament patients are promoted by un-methylated GDNF.
25869129 the PTX-sensitive alpha-subunit of G proteins, Go1 and Gi3, plays an important role in a monoamine-independent production of GDNF evoked by amitriptyline
25753832 Increased plasma levels of GDNF were found in untreated attention deficit hyperactivity disorder patients.
25692823 Data indicate that glial cell-derived neurotrophic factor (GDNF) was down-regulated in the medullary sponge kidney (MSK) cells.
25655772 The glial cell line-derived neurotrophic factor(GDNF)-induced growth and differentiation of cultured enteric neurons is paralleled by increased expression of SNAP-25 and formation of synaptic vesicles reflecting enhanced synaptogenesis.
25619885 improvement in behavioral performance (open-field and grip-strength tests), as well as increased life-span was observed in rodents treated with NCAM-VEGF or NCAM-GDNF co-transfected cells
25575823 Data indicate the glial cell derived neurotrophic factor (GDNF) signaling pathway as a potential target for improving responses to conventional genotoxic therapeutics.
25543333 GDNF levels were significantly higher in mania and lower in schizophrenia compared to healthy controls. BDNF levels were negatively correlated to illness severity scores in affective episodes
More...

AA Sequence

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQA      1 - 70
TIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEEL     71 - 140
IFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGC    141 - 210
I//

Text Mined References (171)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26549420 2016 Upregulation of p?Akt by glial cell line?derived neurotrophic factor ameliorates cell apoptosis in the hippocampus of rats with streptozotocin?induced diabetic encephalopathy.
26337382 Immunohistochemical Analysis of GDNF and Its Cognate Receptor GFR?-1 Protein Expression in Vitiliginous Skin Lesions.
26232065 2016 An Epigenetic Mechanism of High Gdnf Transcription in Glioma Cells Revealed by Specific Sequence Methylation.
26096985 2015 GDNF gene is associated with tourette syndrome in a family study.
25913759 2015 Decreased DNA methylation in the promoter region of the WNT5A and GDNF genes may promote the osteogenicity of mesenchymal stem cells from patients with ossified spinal ligaments.
25869129 2015 Tricyclic Antidepressant Amitriptyline-induced Glial Cell Line-derived Neurotrophic Factor Production Involves Pertussis Toxin-sensitive G?i/o Activation in Astroglial Cells.
25753832 2015 Increased levels of plasma glial-derived neurotrophic factor in children with attention deficit hyperactivity disorder.
25692823 2015 Spontaneous calcification process in primary renal cells from a medullary sponge kidney patient harbouring a GDNF mutation.
25655772 2015 SNAP-25 is abundantly expressed in enteric neuronal networks and upregulated by the neurotrophic factor GDNF.
More...