Property Summary

NCBI Gene PubMed Count 178
PubMed Score 2403.37
PubTator Score 927.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
osteosarcoma 7950 3.5e-05
cystic fibrosis 1696 1.9e-04
medulloblastoma, large-cell 6241 1.2e-02
Disease Target Count
Hirschsprung's disease 46

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.183 1.9e-04
medulloblastoma, large-cell 1.800 1.2e-02
osteosarcoma 1.280 3.5e-05

Protein-protein Interaction (3)

Gene RIF (140)

AA Sequence

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQA      1 - 70
TIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEEL     71 - 140
IFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGC    141 - 210
I//

Text Mined References (180)

PMID Year Title