Property Summary

NCBI Gene PubMed Count 154
PubMed Score 0.00
PubTator Score 280.51

Knowledge Summary

Patent

No data available

Synonym

Accession P39900 B2R9X8 B7ZLF6 Q2M1L9 MME
Symbols ME
HME
MME
MMP-12

Gene

PDB

1JIZ   1JK3   1OS2   1OS9   1RMZ   1ROS   1UTT   1UTZ   1Y93   1YCM   1Z3J   2HU6   2JXY   2K2G   2K9C   2KRJ   2MLR   2MLS   2N8R   2OXU   2OXW   2OXZ   2POJ   2W0D   2WO8   2WO9   2WOA   2Z2D   3BA0   3EHX   3EHY   3F15   3F16   3F17   3F18   3F19   3F1A   3LIK   3LIL   3LIR   3LJG   3LK8   3LKA   3N2U   3N2V   3NX7   3RTS   3RTT   3TS4   3TSK   3UVC   4EFS   4GQL   4GR0   4GR3   4GR8   4GUY   4H30   4H49   4H76   4H84   4I03   4IJO   5CXA   5CZM   5D2B   5D3C   5I0L   5I2Z   5I3M   5I43   5I4O   5L79   5L7F   5LAB  

Gene RIF (152)

PMID Text
26887942 Productive complex between MMP-12 and synthetic triple-helical collagen V, are revealed through paramagnetic NMR.
26608672 MMP12 causes arterial stiffening in mice and suggest that it functions similarly in humans.
26120586 Patients with Primary Open-Angle Glaucoma are characterized by an increased mRNA expression of MMP1, MMP9, MMP12, TIMP1 and IL-1b genes as compared to the control group .
26040769 These results proved that MMP-12 expression was increased in cutaneous melanoma and associated with tumor progression. It also provided the first evidence that MMP-12 level could be an independent prognostic marker for patients with cutaneous melanoma
25435370 fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12.
25078452 We identified a novel association with an MMP12 locus in large artery atherosclerosis (rs660599; p = 2.5x10), with independent replication in a second population
25006744 MMP12 is located in genes previously associated with chronic obstructive pulmonary disease susceptibility.
24914938 Macrophage MMP12 regulates adipose tissue expansion, insulin sensitivity, and expression of inducible nitric oxide synthase.
24885469 HnRNP K can induce MMP12 expression and enzyme activity through activating MMP12 promoter, which promotes cell migration and invasion in nasopharyngeal carcinoma cells.
24834994 findings showed that there was an important joint effect of the MMP-12 polymorphisms and Type 2 Diabetes Mellitus on the risk of Ischemic Stroke and therefore it can be considered as a potential marker of cerebrovascular disorders in diabetic patients.
More...

AA Sequence

MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHF      1 - 70
LGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQV     71 - 140
WSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGT    141 - 210
NLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPA    211 - 280
LCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDD    281 - 350
KYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK    351 - 420
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC                        421 - 470
//

Text Mined References (155)

PMID Year Title
26887942 2016 Path to Collagenolysis: COLLAGEN V TRIPLE-HELIX MODEL BOUND PRODUCTIVELY AND IN ENCOUNTERS BY MATRIX METALLOPROTEINASE-12.
26608672 2015 Matrix metalloproteinase-12 is an essential mediator of acute and chronic arterial stiffening.
26120586 2015 Altered Expression Levels of MMP1, MMP9, MMP12, TIMP1, and IL-1? as a Risk Factor for the Elevated IOP and Optic Nerve Head Damage in the Primary Open-Angle Glaucoma Patients.
26040769 2015 Matrix metalloproteinase-12 expression is increased in cutaneous melanoma and associated with tumor aggressiveness.
25435370 2015 Fluid shear promotes chondrosarcoma cell invasion by activating matrix metalloproteinase 12 via IGF-2 and VEGF signaling pathways.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25078452 2014 A novel MMP12 locus is associated with large artery atherosclerotic stroke using a genome-wide age-at-onset informed approach.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24914938 2014 Macrophage metalloelastase (MMP12) regulates adipose tissue expansion, insulin sensitivity, and expression of inducible nitric oxide synthase.
24885469 2014 Matrix metalloproteinase 12 is induced by heterogeneous nuclear ribonucleoprotein K and promotes migration and invasion in nasopharyngeal carcinoma.
More...