Property Summary

Ligand Count 375
NCBI Gene PubMed Count 166
PubMed Score 0.00
PubTator Score 280.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.026 2.1e-02
adult high grade glioma 1.100 1.1e-03
Atopic dermatitis 3.400 4.6e-04
atypical teratoid / rhabdoid tumor 2.600 4.3e-03
Breast cancer 1.100 2.8e-02
ductal carcinoma in situ 4.700 4.4e-03
esophageal adenocarcinoma 1.800 4.8e-02
glioblastoma 1.100 9.4e-03
group 3 medulloblastoma 2.200 1.1e-02
head and neck cancer and chronic obstruc... 3.200 1.0e-02
interstitial cystitis 4.100 3.8e-04
intraductal papillary-mucinous adenoma (... 2.500 1.9e-02
invasive ductal carcinoma 2.400 2.0e-02
lung adenocarcinoma 1.900 7.1e-08
lung cancer 4.700 2.4e-06
nasopharyngeal carcinoma 2.000 2.1e-03
non-small cell lung cancer 5.626 1.3e-28
ovarian cancer 1.400 5.6e-04
pancreatic cancer 2.500 9.6e-04
periodontitis 1.400 1.5e-15
psoriasis 2.200 1.9e-06
sarcoidosis 4.900 1.4e-02
ulcerative colitis 5.300 1.6e-09

 Compartment GO Term (0)

Gene RIF (164)

AA Sequence

MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHF      1 - 70
LGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQV     71 - 140
WSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGT    141 - 210
NLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPA    211 - 280
LCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDD    281 - 350
KYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK    351 - 420
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC                        421 - 470
//

Text Mined References (167)

PMID Year Title