Property Summary

NCBI Gene PubMed Count 82
PubMed Score 421.36
PubTator Score 800.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession P39880 B3KV79 J3KQV9 Q6NYH4 Q75LE5 Q75MT2 Q75MT3 Q86UJ7 Q9UEV5
Symbols CDP
CUX
p75
CASP
CDP1
COY1
Clox
p100
p110
p200
CUTL1
GOLIM6
CDP/Cut
Cux/CDP
Nbla10317

Gene

Gene RIF (53)

PMID Text
25248790 High CUX1 expression is associated with metastasis in pancreatic neuroendocrine neoplasms.
25190083 CUX1 expression is associated with tumour progression and tumor burden. [Review]
25159843 CASP is specifically cleaved by granzymeB.
25124494 This is a novel gene implicated in atrial fibrillation
25096634 Results show that Cux1 is expressed in cerebellar granule cell precursors and downregulated as they terminally differentiate; coexpression analysis in human medulloblastomas suggests another function related to DNA integrity and stability
24686420 Suggest that CUTL1 may regulate the proliferation of malignant melanoma by modulating the expression of cell cycle-related proteins.
24429498 Loss of CUX1 is associated with myeloid neoplasms.
24336331 Authors identified CUX1 as an important modulator of the TAMs phenotype and function by modulating NF-kappaB-dependent cytokines.
24316979 Cux1 is a tumor suppressor and inactivating CUX1 mutations promote tumorigenesis.
23590133 p110 CUX1 can mediate transcriptional repression or activation of specific genes when bound at variable distances from the transcription start site.
More...

AA Sequence

MLCVAGARLKRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKR      1 - 70
SKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIK     71 - 140
ALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSLQTALEKTRTE    141 - 210
LFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAI    211 - 280
EVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQAD    281 - 350
YEEVKKELNILKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGSARRKGKDQPES    351 - 420
RRPGSLPAPPPSQLPRNPGEQASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFALNSLLQRQLMQ    421 - 490
SFYSKAMQEAGSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSESAGSVSEGEEMDTAEIARQV    491 - 560
KEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNILALRSIQGRQ    561 - 630
RENPGQSLNRLFQEVPKRRNGSEGNITTRIRASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSG    631 - 700
NSDDAIRSILQQARREMEAQQAALDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAA    701 - 770
PEAGASALPNPPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEE    771 - 840
AKAEETGGGKEKGSGGSGGGSQPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGASRSETPQNSP    841 - 910
LPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSD    911 - 980
MLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPVLHSVTSLQDPLQQGCVSSESTPKTS    981 - 1050
ASCSPAPESPMSSSESVKSLTELVQQPCPPIEASKDSKPPEPSDPPASDSQPTTPLPLSGHSALSIQELV   1051 - 1120
AMSPELDTYGITKRVKEVLTDNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLN   1121 - 1190
DPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALK   1191 - 1260
RAYQQKPYPSPKTIEDLATQLNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSARSGRAA   1261 - 1330
PSSEGDSCDGVEATEGPGSADTEEPKSQGEAEREEVPRPAEQTEPPPSGTPGPDDARDDDHEGGPVEGPG   1331 - 1400
PLPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPPPSNSSSSSAPRRPSSLQSLFGLPEAAGARD   1401 - 1470
SRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF                                      1471 - 1505
//

Text Mined References (92)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25248790 2014 CUX1: a modulator of tumour aggressiveness in pancreatic neuroendocrine neoplasms.
25190083 2014 CUX1, a haploinsufficient tumour suppressor gene overexpressed in advanced cancers.
25159843 2014 Cytohesin-associated scaffolding protein (CASP) is a substrate for granzyme B and ubiquitination.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
25096634 2014 The transcription factor Cux1 in cerebellar granule cell development and medulloblastoma pathogenesis.
24686420 2014 The transcription factor CUTL1 is associated with proliferation and prognosis in malignant melanoma.
24429498 2014 Recurrent genetic defects on chromosome 7q in myeloid neoplasms.
More...