Property Summary

NCBI Gene PubMed Count 45
Grant Count 42
R01 Count 38
Funding $3,680,238.63
PubMed Score 26.72
PubTator Score 44.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.900 0.018
ependymoma -1.900 0.040
oligodendroglioma -1.700 0.044
glioblastoma multiforme 1.300 0.000
osteosarcoma -1.671 0.025
sonic hedgehog group medulloblastoma -3.200 0.000
atypical teratoid / rhabdoid tumor -2.000 0.001
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -2.700 0.002
lung cancer -1.200 0.001
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.200 0.011

Gene RIF (30)

PMID Text
25549071 The clinical findings in this family suggest a diagnosis of benign familial fleck retina with excellent prognosis, in which the PLA2G5 gene may play a role.
25247183 Summarizing, Der p1 and Fel d1 involve phospholipase A2 enzymes in their action.
25132377 expression of PLA2s-IIE and -V correlates with the development of calcification as well as the expression of pro-osteogenic molecules in human aortic valves
25069533 sPLA2-V plays a thrombogenic role by impairing the ability of EPCR to promote protein C activation.
24959594 Our results demonstrate the association of the PLA2G5 rs11573191 polymorphism with premature CAD. In our study, it was possible to distinguish one haplotype associated with increased risk of premature CAD and hypertension.
24563418 There is no association between rs525380 polymorphism of PLA2G5 and coronary heart disease.
24495480 results demonstrate that EPCR is overexpressed and mediates the aggressive behavior of rheumatoid synovial fibroblasts, and is likely driven by group V secretory phospholipase A2
24042857 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillindependent pathway.
23650617 Our studies identified a unique function of gV-sPLA2 in activation of macrophages
22137173 Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina
More...

AA Sequence

MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHC      1 - 70
YGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS       71 - 138
//

Text Mined References (45)

PMID Year Title
25549071 2015 Phospholipase A2 group v in benign familial fleck retina in a set of triplets.
25247183 2014 The step further to understand the role of cytosolic phospholipase A2 alpha and group X secretory phospholipase A2 in allergic inflammation: pilot study.
25132377 2014 The expression of groups IIE and V phospholipase A2 is associated with an increased expression of osteogenic molecules in human calcified aortic valves.
25069533 2014 Group V secretory phospholipase A2 impairs endothelial protein C receptor-dependent protein C activation and accelerates thrombosis in vivo.
24959594 2014 The (G>A) rs11573191 polymorphism of PLA2G5 gene is associated with premature coronary artery disease in the Mexican Mestizo population: the genetics of atherosclerotic disease Mexican study.
24563418 2014 Novel genetic approach to investigate the role of plasma secretory phospholipase A2 (sPLA2)-V isoenzyme in coronary heart disease: modified Mendelian randomization analysis using PLA2G5 expression levels.
24495480 2014 Endothelial protein C receptor-associated invasiveness of rheumatoid synovial fibroblasts is likely driven by group V secretory phospholipase A2.
24042857 2013 Human group V secretory phospholipase A2 is associated with lipid rafts and internalized in a flotillin?dependent pathway.
23650617 2013 Group V secretory phospholipase A2 is involved in macrophage activation and is sufficient for macrophage effector functions in allergic pulmonary inflammation.
22837859 Group V phospholipase A(2) increases pulmonary endothelial permeability through direct hydrolysis of the cell membrane.
More...