Property Summary

NCBI Gene PubMed Count 144
Grant Count 230
R01 Count 132
Funding $36,076,474.3
PubMed Score 533.76
PubTator Score 334.40

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P39748 FEN-1
Symbols MF1
RAD2
FEN-1

Gene

PDB

1U7B   1UL1   3Q8K   3Q8L   3Q8M   3UVU   5E0V   5FV7  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
488813 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of Human Flap endonuclease 1 (FEN1)
488816 confirmatory 56 / 27 / 1197 qHTS Validation Assay for the Inhibitors of Human Flap endonuclease 1 (FEN1)
588795 confirmatory 1368 / 7663 / 382244 qHTS Assay for the Inhibitors of Human Flap endonuclease 1 (FEN1).
720498 confirmatory 696 / 186 / 0 qHTS Assay for the Inhibitors of FEN1: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (99)

PMID Text
26884332 Binding of DNA to human FEN1 in a bent conformation occurred independently of 5'-flap accommodation and did not require active site metal ions or the presence of conserved active site residues.
26751069 WDR4 regulates FEN1's potential DNA cleavage threat near the site of replication.
26718738 the aim of the present study was to determine the role of FEN1 in the chemosensitivity of SGC7901 cells.
26708601 The FEN1 rs174538 A allele is a protective biomarker for childhood ALL and this association is more significant in males and in patients at onset age of 3.5 years or older.
26668074 Data indicate that Flap endonuclease 1 (FEN1) single nucleotide polymorphisms and haplotypes are associated with gallbladder cancer risk.
26581212 Under DNA repair conditions, FEN1 efficiently repaired the 5'-phoshotyrosyl bond-containing SSB substrates in the presence of DNA ligase and DNA polymerase.
26431531 Patients with expression of both FEN1 and RAD54B were prone to have advanced nodal involvement and significantly poor prognosis.
26221031 EXO1 and FEN1 cleaved the substrate at the boundary between the single-stranded 5' flap and the duplex, whereas FAN1 incised it three to four nucleotides in the double-stranded region.
26160176 Rate-determining step of FEN1 reflects a kinetic bias against long flaps and trinucleotide repeat sequences.
26032365 In this study, we found that cohesion establishment factors, like CHlR1, cooperatively stimulate endonuclease activity of hFen1 in in vivo mimic condition, including replication protein-A-coated DNA and high salt.
More...

AA Sequence

MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYR      1 - 70
TIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDE     71 - 140
CKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLS    141 - 210
RILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAH    211 - 280
QLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL    281 - 350
SSAKRKEPEPKGSTKKKAKTGAAGKFKRGK                                            351 - 380
//

Text Mined References (152)

PMID Year Title
26884332 2016 DNA and Protein Requirements for Substrate Conformational Changes Necessary for Human Flap Endonuclease-1-catalyzed Reaction.
26751069 2016 Wuho Is a New Member in Maintaining Genome Stability through its Interaction with Flap Endonuclease 1.
26718738 2016 Flap endonuclease 1 silencing is associated with increasing the cisplatin sensitivity of SGC?7901 gastric cancer cells.
26708601 The Association of Flap Endonuclease 1 Genotypes with the Risk of Childhood Leukemia.
26668074 2015 Variants and haplotypes in Flap endonuclease 1 and risk of gallbladder cancer and gallstones: a population-based study in China.
26581212 2016 FEN1 participates in repair of the 5'-phosphotyrosyl terminus of DNA single-strand breaks.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26431531 2015 The Overexpression of FEN1 and RAD54B May Act as Independent Prognostic Factors of Lung Adenocarcinoma.
26221031 2015 FANCD2-associated nuclease 1, but not exonuclease 1 or flap endonuclease 1, is able to unhook DNA interstrand cross-links in vitro.
26160176 2015 Rate-determining Step of Flap Endonuclease 1 (FEN1) Reflects a Kinetic Bias against Long Flaps and Trinucleotide Repeat Sequences.
More...