Property Summary

Ligand Count 35
NCBI Gene PubMed Count 149
PubMed Score 617.00
PubTator Score 334.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Breast cancer 2.300 4.0e-02
colon cancer 1.300 4.6e-05
ductal carcinoma in situ 1.100 2.1e-03
Endometriosis 1.155 3.0e-02
group 3 medulloblastoma 1.600 1.0e-04
intraductal papillary-mucinous carcinoma... 1.500 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.100 1.9e-03
invasive ductal carcinoma 1.600 3.3e-04
lung adenocarcinoma 1.007 5.7e-04
lung cancer 2.400 9.6e-06
malignant mesothelioma 1.200 7.3e-07
medulloblastoma, large-cell 1.100 9.2e-05
nasopharyngeal carcinoma 1.100 2.8e-05
non-small cell lung cancer 2.012 2.6e-30
osteosarcoma -2.401 2.1e-04
ovarian cancer 1.100 3.9e-06
psoriasis 1.100 6.0e-15
subependymal giant cell astrocytoma -1.322 1.5e-02
ulcerative colitis 1.300 2.0e-05
Waldenstrons macroglobulinemia 1.727 3.8e-03

Protein-protein Interaction (2)

Gene RIF (103)

AA Sequence

MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYR      1 - 70
TIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDE     71 - 140
CKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLS    141 - 210
RILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAH    211 - 280
QLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL    281 - 350
SSAKRKEPEPKGSTKKKAKTGAAGKFKRGK                                            351 - 380
//

Text Mined References (156)

PMID Year Title