Property Summary

NCBI Gene PubMed Count 56
Grant Count 60
R01 Count 27
Funding $5,122,230.56
PubMed Score 144.37
PubTator Score 82.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.725 0.003
Multiple myeloma 1.545 0.001
oligodendroglioma 1.300 0.014
psoriasis -2.700 0.000
osteosarcoma -1.506 0.000
sonic hedgehog group medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.300 0.001
Breast cancer 2.400 0.026
posterior fossa group B ependymoma 1.200 0.000
subependymal giant cell astrocytoma -1.203 0.025
ovarian cancer 2.000 0.000
dermatomyositis 1.100 0.000

Synonym

Accession P39687 B2R6T4 Q53FK4 Q5J8L8 Q7M4N6
Symbols LANP
MAPM
PP32
HPPCn
PHAP1
PHAPI
I1PP2A
C15orf1

Gene

PDB

2JE0   2JE1   4XOS  

Gene RIF (30)

PMID Text
26738596 ANP32A represents an essential host partner co-opted to support influenza virus replication and is a candidate host target for novel antivirals
26512887 Host-derived proteins pp32 and APRIL interact with a free form of influenza virus RNA-dependent RNA polymerase and preferentially upregulates viral RNA synthesis rather than cRNA synthesis.
26057796 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A) has been reported.
25902505 conformational analysis of the C-terminal transition state of the leucine-rich repeat domain of PP32
23839903 Demonstrate that HPPCn attenuated oxidative injury and fibrosis induced by ethanol feeding and that the SphK1/S1P/S1PRs signalling pathway contributes to this protective effect.
22174317 The interaction of Rev with ANP32A is decreased by the presence of RRE
22174317 The interaction of Rev with ANP32A is decreased by the presence of RRE
21325029 pp32 interacted with STAT1 and STAT2 in an IFNB-dependent manner.
21317927 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21152064 Data provide evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.
More...

AA Sequence

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE      1 - 70
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP     71 - 140
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED    141 - 210
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD                                   211 - 249
//

Text Mined References (65)

PMID Year Title
26738596 2016 Species difference in ANP32A underlies influenza A virus polymerase host restriction.
26512887 2015 pp32 and APRIL are host cell-derived regulators of influenza virus RNA synthesis from cRNA.
26057796 2015 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902505 2015 Highly polarized C-terminal transition state of the leucine-rich repeat domain of PP32 is governed by local stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839903 2013 Hepatopoietin Cn reduces ethanol-induced hepatoxicity via sphingosine kinase 1 and sphingosine 1-phosphate receptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21806989 2011 Mechanism of inhibition of PP2A activity and abnormal hyperphosphorylation of tau by I2(PP2A)/SET.
More...