Property Summary

NCBI Gene PubMed Count 59
PubMed Score 153.61
PubTator Score 82.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 2.400 2.6e-02
dermatomyositis 1.100 3.1e-04
group 3 medulloblastoma 1.700 1.2e-03
medulloblastoma, large-cell 1.300 5.4e-04
Multiple myeloma 1.545 1.3e-03
oligodendroglioma 1.300 1.4e-02
osteosarcoma -1.506 7.0e-05
ovarian cancer 2.000 1.3e-04
posterior fossa group B ependymoma 1.200 6.4e-06
psoriasis -1.100 8.3e-07
subependymal giant cell astrocytoma -1.203 2.5e-02
Waldenstrons macroglobulinemia 1.725 2.8e-03

Gene RIF (32)

AA Sequence

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE      1 - 70
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP     71 - 140
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED    141 - 210
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD                                   211 - 249
//

Text Mined References (68)

PMID Year Title