Property Summary

NCBI Gene PubMed Count 56
PubMed Score 144.37
PubTator Score 82.94

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 6.37488122000929E-6
psoriasis 6685 1.94662083138628E-5
sonic hedgehog group medulloblastoma 1482 2.14648138956325E-5
osteosarcoma 7933 7.00301678179974E-5
ovarian cancer 8492 1.25378261605474E-4
dermatomyositis 967 3.10278716293121E-4
medulloblastoma, large-cell 6234 5.37945508826906E-4
Multiple myeloma 1328 0.00130061310475288
Waldenstrons macroglobulinemia 765 0.00278166720050853
oligodendroglioma 2849 0.0136157568110019
subependymal giant cell astrocytoma 2287 0.0251999420238727
Breast cancer 3099 0.0260219833290876
Disease Target Count Z-score Confidence
Esophageal cancer 30 0.0 2.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 1 16 4.788 2.4


  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.725 0.003
Multiple myeloma 1.545 0.001
oligodendroglioma 1.300 0.014
psoriasis -2.700 0.000
osteosarcoma -1.506 0.000
sonic hedgehog group medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.300 0.001
Breast cancer 2.400 0.026
posterior fossa group B ependymoma 1.200 0.000
subependymal giant cell astrocytoma -1.203 0.025
ovarian cancer 2.000 0.000
dermatomyositis 1.100 0.000


Accession P39687 B2R6T4 Q53FK4 Q5J8L8 Q7M4N6
Symbols LANP



2JE0   2JE1   4XOS  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 MGI Term (1)

Gene RIF (29)

26738596 ANP32A represents an essential host partner co-opted to support influenza virus replication and is a candidate host target for novel antivirals
26512887 Host-derived proteins pp32 and APRIL interact with a free form of influenza virus RNA-dependent RNA polymerase and preferentially upregulates viral RNA synthesis rather than cRNA synthesis.
26057796 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A) has been reported.
25902505 conformational analysis of the C-terminal transition state of the leucine-rich repeat domain of PP32
23839903 Demonstrate that HPPCn attenuated oxidative injury and fibrosis induced by ethanol feeding and that the SphK1/S1P/S1PRs signalling pathway contributes to this protective effect.
22174317 The interaction of Rev with ANP32A is decreased by the presence of RRE
21325029 pp32 interacted with STAT1 and STAT2 in an IFNB-dependent manner.
21317927 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21152064 Data provide evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.
20683644 The HPPCn expression might be involved in the development of hepatocellular carcinoma and could be served as a promising biomarker.

AA Sequence

EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD                                   211 - 249

Text Mined References (65)

PMID Year Title
26738596 2016 Species difference in ANP32A underlies influenza A virus polymerase host restriction.
26512887 2015 pp32 and APRIL are host cell-derived regulators of influenza virus RNA synthesis from cRNA.
26057796 2015 High-resolution crystal structure of the leucine-rich repeat domain of the human tumour suppressor PP32A (ANP32A).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902505 2015 Highly polarized C-terminal transition state of the leucine-rich repeat domain of PP32 is governed by local stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839903 2013 Hepatopoietin Cn reduces ethanol-induced hepatoxicity via sphingosine kinase 1 and sphingosine 1-phosphate receptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21806989 2011 Mechanism of inhibition of PP2A activity and abnormal hyperphosphorylation of tau by I2(PP2A)/SET.