Property Summary

NCBI Gene PubMed Count 19
PubMed Score 40.69
PubTator Score 200.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ependymoma 2514 2.61161731507681E-12
lung adenocarcinoma 2714 2.78687132085198E-10
atypical teratoid/rhabdoid tumor 1095 7.75743131131905E-9
pediatric high grade glioma 2712 2.5442298544064E-7
pilocytic astrocytoma 3086 9.79337054442206E-7
medulloblastoma, large-cell 6234 2.94438093499538E-5
ovarian cancer 8492 4.80088163226635E-5
Multiple myeloma 1328 1.83937725533559E-4
lung cancer 4473 1.95134769735172E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0012455992175928
group 3 medulloblastoma 2254 0.00138501797639754
glioblastoma 5572 0.00195303809589987
Waldenstrons macroglobulinemia 765 0.00362485516641492
osteosarcoma 7933 0.00391552601373647
astrocytoma 1493 0.00727433034627661
non primary Sjogren syndrome sicca 840 0.0405196361091436
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 0.0 4.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.167 1.6

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.239 0.004
Multiple myeloma 1.810 0.000
osteosarcoma 1.231 0.004
ependymoma 1.200 0.000
glioblastoma 2.100 0.002
group 3 medulloblastoma 1.400 0.001
astrocytoma 1.100 0.007
atypical teratoid/rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.300 0.000
intraductal papillary-mucinous neoplasm ... -1.900 0.001
lung cancer 1.100 0.000
diabetes mellitus -1.100 0.010
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.300 0.000
non primary Sjogren syndrome sicca 1.200 0.041
lung adenocarcinoma 1.459 0.000
ovarian cancer 2.100 0.000

Synonym

Accession P39656 B2RDQ4 B4DJE3 B4DLI2 O43244 Q5VWA5 Q8NI93 Q9BUI2 DDOST 48 kDa subunit
Symbols OST
WBP1
AGER1
CDG1R
OST48
OKSWcl45

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify dolichyl-diphosphooligosaccharide--protein glycosyltransferase, HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22305527 Found a 22 bp deletion and a missense mutation in DDOST.
20490454 The common SNPs tested in DDOST, PRKCSH and LGALS3 do not seem to be associated with diabetic micro- or macrovascular complications or with type 1 diabetes in Finnish patients.
20490454 Observational study of gene-disease association. (HuGE Navigator)
19955485 AGER1 provides protection against AGE-induced reactive oxygen species generation via NADPH oxidase and protein kinase C delta.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of dolichyl-diphosphooligosaccharide--protein glycosyltransferase (DDOST; OST48) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDR      1 - 70
GFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRE     71 - 140
LGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPL    141 - 210
VLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGS    211 - 280
QRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG    281 - 350
DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER    351 - 420
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD                                      421 - 456
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22305527 2012 DDOST mutations identified by whole-exome sequencing are implicated in congenital disorders of glycosylation.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20490454 2010 DDOST, PRKCSH and LGALS3, which encode AGE-receptors 1, 2 and 3, respectively, are not associated with diabetic nephropathy in type 1 diabetes.
19955485 2010 AGER1 regulates endothelial cell NADPH oxidase-dependent oxidant stress via PKC-delta: implications for vascular disease.
19946888 2010 Defining the membrane proteome of NK cells.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...