Property Summary

Ligand Count 10
NCBI Gene PubMed Count 21
PubMed Score 44.06
PubTator Score 200.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
diabetes mellitus -1.100 1.0e-02
astrocytoma 1.100 7.3e-03
Astrocytoma, Pilocytic 1.300 8.4e-07
atypical teratoid / rhabdoid tumor 1.300 3.4e-08
ependymoma 1.200 2.6e-12
glioblastoma 1.300 3.4e-08
group 3 medulloblastoma 1.400 1.4e-03
intraductal papillary-mucinous neoplasm ... -1.900 1.2e-03
lung adenocarcinoma 1.459 2.8e-10
lung cancer 1.100 2.0e-04
medulloblastoma, large-cell 1.300 2.9e-05
Multiple myeloma 1.810 1.8e-04
non primary Sjogren syndrome sicca 1.200 4.1e-02
osteosarcoma 1.231 3.9e-03
ovarian cancer -1.100 1.4e-04
pediatric high grade glioma 1.400 2.5e-07
Waldenstrons macroglobulinemia 1.239 3.6e-03

Gene RIF (9)

AA Sequence

MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDR      1 - 70
GFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRE     71 - 140
LGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPL    141 - 210
VLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGS    211 - 280
QRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDG    281 - 350
DDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER    351 - 420
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD                                      421 - 456
//

Text Mined References (28)

PMID Year Title