Property Summary

NCBI Gene PubMed Count 58
Grant Count 43
R01 Count 15
Funding $7,999,114.76
PubMed Score 275.09
PubTator Score 144.09

Knowledge Summary

Patent (72,571)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 0.007
oligodendroglioma -1.200 0.018
osteosarcoma -1.171 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
glioblastoma -2.100 0.000
primitive neuroectodermal tumor -1.500 0.011
pediatric high grade glioma -1.300 0.002
sonic hedgehog group medulloblastoma -1.400 0.000

Gene RIF (32)

PMID Text
26289945 Findings indicate that SNPs in the GRIK1 gene is associated with altered cue-induced brain activation that is related to craving for alcohol and relapse risk.
26277340 Results suggested that the extracellular N-terminal region including the two CUB domains was largely responsible for the distinct regulatory effects of Neto1 and Neto2 on the desensitization properties of GluK1 homomeric receptors
25941919 In the present study, we have shown that gene-gene interaction of components of different systems associated with nicotine reinforcing effects, such as OPRM1 and GRIK1, rather than one gene polymorphism, is associated with smoking behavior.
24978347 These results suggest that the effect of topiramate on drinking behavior, in which the GluK1-containing kainate receptor appears to play a key role, can be dissociated from its effect on weight.
24786948 This found that, among rs2832407*C of GRIK1 homozygotes, topiramate treatment produced the greatest reductions in the expected positive effects of drinking and desire to drink during the treatment period.
24525690 Topiramate treatment for alcohol dependence was significantly more effective in rs2832407 C-allele homozygotes.
23685007 Reduced Homer binding to mGluR5 supports an inhibitory role for Homer interactions with mGluR5 in mediating neuropathy.
22931243 Using the SNaPshot assay, we present evidence for allelic nondisjunction at rs363506 in the GRIK1 gene and rs2834235 and rs7283354 in the GARS-AIRS-GART gene in Down syndrome in India.
22807686 The association at rs455804 implicates GRIK1 as a novel susceptibility gene for HBV-related HCC, suggesting the involvement of glutamate signaling in the development of HBV-related HCC.
22730074 GRIK1 rs469472 to be possibly associated with schizophrenia in our independent case-control and family samples
More...

AA Sequence

MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKFAVTSINRNRT      1 - 70
LMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSV     71 - 140
DNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNK    141 - 210
DAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGF    211 - 280
RLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHR    281 - 350
HKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI    351 - 420
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNIL    421 - 490
GFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKP    491 - 560
NGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFG    561 - 630
VGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAV    631 - 700
RDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI    701 - 770
GGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI    771 - 840
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECGKLIREERGIR    841 - 910
KQSSVHTV                                                                  911 - 918
//

Text Mined References (58)

PMID Year Title
26289945 2015 The effects of single nucleotide polymorphisms in glutamatergic neurotransmission genes on neural response to alcohol cues and craving.
26277340 2015 The auxiliary subunits Neto1 and Neto2 have distinct, subunit-dependent effects at recombinant GluK1- and GluK2-containing kainate receptors.
25941919 2015 Gene-gene interaction of ?-opioid receptor and GluR5 kainate receptor subunit is associated with smoking behavior in a Greek population: presence of a dose allele effect.
24978347 2014 Topiramate's reduction of body mass index in heavy drinkers: lack of moderation by a GRIK1 polymorphism.
24786948 2014 GRIK1 genotype moderates topiramate's effects on daily drinking level, expectations of alcohol's positive effects and desire to drink.
24525690 2014 Topiramate treatment for heavy drinkers: moderation by a GRIK1 polymorphism.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23685007 2013 Nerve injury-induced changes in Homer/glutamate receptor signaling contribute to the development and maintenance of neuropathic pain.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22931243 2012 SNaPshot Assay in Quantitative Detection of Allelic Nondisjunction in Down Syndrome.
More...