Property Summary

Ligand Count 152
NCBI Gene PubMed Count 60
PubMed Score 279.67
PubTator Score 144.09

Knowledge Summary

Patent (72,571)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.500 7.1e-03
atypical teratoid / rhabdoid tumor -1.100 1.6e-02
glioblastoma -1.300 2.3e-02
oligodendroglioma -1.200 1.8e-02
osteosarcoma -1.171 1.4e-04
pediatric high grade glioma -1.200 8.6e-03
primitive neuroectodermal tumor -1.500 1.1e-02
sonic hedgehog group medulloblastoma -1.400 3.5e-05

Protein-protein Interaction (1)

Gene RIF (34)

AA Sequence

MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKFAVTSINRNRT      1 - 70
LMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSV     71 - 140
DNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNK    141 - 210
DAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGF    211 - 280
RLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHR    281 - 350
HKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI    351 - 420
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNIL    421 - 490
GFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKP    491 - 560
NGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFG    561 - 630
VGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAV    631 - 700
RDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI    701 - 770
GGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI    771 - 840
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECGKLIREERGIR    841 - 910
KQSSVHTV                                                                  911 - 918
//

Text Mined References (60)

PMID Year Title