Property Summary

NCBI Gene PubMed Count 180
Grant Count 275
R01 Count 191
Funding $34,671,665.09
PubMed Score 1499.90
PubTator Score 819.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PDB

1BNL   3HON   3HSH  

 GWAS Trait (1)

Gene RIF (134)

PMID Text
27214260 Endostatin is increased in patients with primary sjogren's syndrome patients with interstitial lung disease.
26771970 Collaterals formation seems to be associated with the activation of pro-inflammatory factors, growth factors and endostatin in chronic heart failure.
26315510 Data show that endostatin levels were elevated in patients with systemic sclerosis (SSc) and mixed connective tissue disease (MCTD).
26275402 promoter methylation significantly increased in nasal polyp tissues
25840998 the intima+media of IPAH vessels, collagens (COL4A5, COL14A1, and COL18A1), matrix metalloproteinase (MMP) 19, and a disintegrin and metalloprotease (ADAM) 33 were higher expressed, whereas MMP10, ADAM17, TIMP1, and TIMP3 were less abundant.
25788476 Study demonstrates that endostatin has novel ATPase activity, which mediates its antiangiogenic and antitumor activities.
25489667 In 2 large cohort studies using serum endostatin as a marker for disease severity and mortality in pulmonary arterial hypertension, a variant in the gene encoding ES, Col18a1, was linked independently with reduced mortality.
25481287 ADAM8 and endostatin play a role in osteosarcoma progression.
25424718 Genebased analyses revealed associations of the COL18A1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis.
25339042 High endostatin expression is associated with malignant pleural effusions in lung cancer.
More...

AA Sequence

MAPYPCGCHILLLLFCCLAAARANLLNLNWLWFNNEDTSHAATTIPEPQGPLPVQPTADTTTHVTPRNGS      1 - 70
TEPATAPGSPEPPSELLEDGQDTPTSAESPDAPEENIAGVGAEILNVAKGIRSFVQLWNDTVPTESLARA     71 - 140
ETLVLETPVGPLALAGPSSTPQENGTTLWPSRGIPSSPGAHTTEAGTLPAPTPSPPSLGRPWAPLTGPSV    141 - 210
PPPSSGRASLSSLLGGAPPWGSLQDPDSQGLSPAAAAPSQQLQRPDVRLRTPLLHPLVMGSLGKHAAPSA    211 - 280
FSSGLPGALSQVAVTTLTRDSGAWVSHVANSVGPGLANNSALLGADPEAPAGRCLPLPPSLPVCGHLGIS    281 - 350
RFWLPNHLHHESGEQVRAGARAWGGLLQTHCHPFLAWFFCLLLVPPCGSVPPPAPPPCCQFCEALQDACW    351 - 420
SRLGGGRLPVACASLPTQEDGYCVLIGPAAERISEEVGLLQLLGDPPPQQVTQTDDPDVGLAYVFGPDAN    421 - 490
SGQVARYHFPSLFFRDFSLLFHIRPATEGPGVLFAITDSAQAMVLLGVKLSGVQDGHQDISLLYTEPGAG    491 - 560
QTHTAASFRLPAFVGQWTHLALSVAGGFVALYVDCEEFQRMPLARSSRGLELEPGAGLFVAQAGGADPDK    561 - 630
FQGVIAELKVRRDPQVSPMHCLDEEGDDSDGASGDSGSGLGDARELLREETGAALKPRLPAPPPVTTPPL    631 - 700
AGGSSTEDSRSEEVEEQTTVASLGAQTLPGSDSVSTWDGSVRTPGGRVKEGGLKGQKGEPGVPGPPGRAG    701 - 770
PPGSPCLPGPPGLPCPVSPLGPAGPALQTVPGPQGPPGPPGRDGTPGRDGEPGDPGEDGKPGDTGPQGFP    771 - 840
GTPGDVGPKGDKGDPGVGERGPPGPQGPPGPPGPSFRHDKLTFIDMEGSGFGGDLEALRGPRGFPGPPGP    841 - 910
PGVPGLPGEPGRFGVNSSDVPGPAGLPGVPGREGPPGFPGLPGPPGPPGREGPPGRTGQKGSLGEAGAPG    911 - 980
HKGSKGAPGPAGARGESGLAGAPGPAGPPGPPGPPGPPGPGLPAGFDDMEGSGGPFWSTARSADGPQGPP    981 - 1050
GLPGLKGDPGVPGLPGAKGEVGADGVPGFPGLPGREGIAGPQGPKGDRGSRGEKGDPGKDGVGQPGLPGP   1051 - 1120
PGPPGPVVYVSEQDGSVLSVPGPEGRPGFAGFPGPAGPKGNLGSKGERGSPGPKGEKGEPGSIFSPDGGA   1121 - 1190
LGPAQKGAKGEPGFRGPPGPYGRPGYKGEIGFPGRPGRPGMNGLKGEKGEPGDASLGFGMRGMPGPPGPP   1191 - 1260
GPPGPPGTPVYDSNVFAESSRPGPPGLPGNQGPPGPKGAKGEVGPPGPPGQFPFDFLQLEAEMKGEKGDR   1261 - 1330
GDAGQKGERGEPGGGGFFGSSLPGPPGPPGPPGPRGYPGIPGPKGESIRGQPGPPGPQGPPGIGYEGRQG   1331 - 1400
PPGPPGPPGPPSFPGPHRQTISVPGPPGPPGPPGPPGTMGASSGVRLWATRQAMLGQVHEVPEGWLIFVA   1401 - 1470
EQEELYVRVQNGFRKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASP   1471 - 1540
PRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARA   1541 - 1610
VGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVL   1611 - 1680
RHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFM   1681 - 1750
TASK                                                                     1751 - 1754
//

Text Mined References (182)

PMID Year Title
27214260 Endostatin is higher and associated with pulmonary involvement in primary Sjögren's syndrome.
26771970 Expression of Proinflammatory Factors, Proangiogenic Factors and Endostatin in Patients with Heart Failure and Different Grades of Collateral Circulation Development.
26315510 2015 Associations between circulating endostatin levels and vascular organ damage in systemic sclerosis and mixed connective tissue disease: an observational study.
26275402 2015 Pilot study of DNA methylation in the pathogenesis of chronic rhinosinusitis with nasal polyps.
25840998 2015 Compartment-specific expression of collagens and their processing enzymes in intrapulmonary arteries of IPAH patients.
25788476 2015 Endostatin has ATPase activity, which mediates its antiangiogenic and antitumor activities.
25489667 2015 Serum endostatin is a genetically determined predictor of survival in pulmonary arterial hypertension.
25481287 2015 Expression of a disintegrin and metalloprotease 8 and endostatin in human osteosarcoma: implication in tumor progression and prognosis.
25456301 2014 Brain malformations associated with Knobloch syndrome--review of literature, expanding clinical spectrum, and identification of novel mutations.
25424718 2015 Associations of Endothelial System Genes With Blood Pressure Changes and Hypertension Incidence: The GenSalt Study.
More...