Property Summary

NCBI Gene PubMed Count 34
PubMed Score 14.12
PubTator Score 24.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P39059 Q5T6J4 Q9UDC5 Q9Y4W4
Symbols

Gene

PDB

3N3F  

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26937007 This study demonstrated that novel role for collagen XV in motor axon pathfinding and neuromuscular development.
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25134534 we identified an epithelial ovarian cancer susceptibility loci at 9q22.33 (rs1413299 in COL15A1, P(meta) = 1.88 x 10(-8))
23912340 COL15A1, provide evidence for concomitant epigenetic regulation and genetic susceptibility, and define a class of causal targets that sit at the intersection of genetic and epigenetic predisposition in the etiology of complex disease.
23621901 These results suggest genetic variation in COL15A1 and COL18A1 can modify the age of onset of both early and late onset POAG.
22034088 Collagen type XV and osteocalcin expression are highly sensitive markers to extracellular calcium
20932905 the crystal structure of the trimerization domain of human type XV collagen
19834535 Observational study of gene-disease association. (HuGE Navigator)
19365806 Data represent the first evidence of the expression of collagen type XV in human osteoblasts, a calcium-regulated protein which correlates to a specific functional state of these cells.
18203317 Polymorphisms in COL15 (collagen XV) gene are not associated with systemic sclerosis
More...

AA Sequence

MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRGATETASQGHLDLTQLIGVPLPSSVSFVTGYGGFPAYSFG      1 - 70
PGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYLGLRLSGVEDGHQRIILYYTE     71 - 140
PGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCEEHSRIPFQRSSQALAFESSAGIFMGNAGAT    141 - 210
GLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTP    211 - 280
PTPSSPFEDMELSGEPVPEGTLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLD    281 - 350
IAEEKNLAATAAGLAEVPISTAGEAEASSVPTGGPTLSMSTENPEEGVTPGPDNEERLAATAAGEAEALA    351 - 420
SMPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLT    421 - 490
ATMAPERAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPTVAPERWITPAQREHVGMKGQ    491 - 560
AGPKGEKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWGSDVGSGSGDLVGSEQLLRGPPGPPGPPGLP    561 - 630
GIPGKPGTDVFMGPPGSPGEDGPAGEPGPPGPEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRG    631 - 700
LPGPPGKKGQAGPPGVMGPPGPPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPTAAIGLKGEKG    701 - 770
DRGPKGERGMDGASIVGPPGPRGPPGHIKVLSNSLINITHGFMNFSDIPELVGPPGPDGLPGLPGFPGPR    771 - 840
GPKGDTGLPGFPGLKGEQGEKGEPGAILTEDIPLERLMGKKGEPGMHGAPGPMGPKGPPGHKGEFGLPGR    841 - 910
PGRPGLNGLKGTKGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIPVRPHCKMPVDTAHPGSPELI    911 - 980
TFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLRHFLNNLKGENGDKGFKGEKGEKGDINGSFL    981 - 1050
MSGPPGLPGNPGPAGQKGETVVGPQGPPGAPGLPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPP   1051 - 1120
GPPGQPGLPGSRNLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPP   1121 - 1190
PPALSSNPHQLLPPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQD   1191 - 1260
LSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPH   1261 - 1330
GVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIENSFMTDARK               1331 - 1388
//

Text Mined References (35)

PMID Year Title
26937007 2016 Slow Muscle Precursors Lay Down a Collagen XV Matrix Fingerprint to Guide Motor Axon Navigation.
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
23912340 2013 Epigenetic regulation of COL15A1 in smooth muscle cell replicative aging and atherosclerosis.
23621901 2013 Variations in COL15A1 and COL18A1 influence age of onset of primary open angle glaucoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22531369 2012 Tumor suppression by collagen XV is independent of the restin domain.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
More...