Property Summary

NCBI Gene PubMed Count 87
Grant Count 93
R01 Count 49
Funding $16,936,077.28
PubMed Score 1305.74
PubTator Score 143.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.610 0.002
astrocytoma 1.100 0.000
glioblastoma multiforme 1.200 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.100 0.000
lung cancer -2.400 0.043
fibroadenoma 1.100 0.014
diabetes mellitus -1.300 0.003
sonic hedgehog group medulloblastoma 1.600 0.000

Synonym

Accession P39019
Symbols DBA
S19
DBA1

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (52)

PMID Text
25270909 Data indicate that GATA1 transcription factor is downregulated in ribosomal protein S19 (RPS19)-deficient cells through upregulation of TNF-alpha and p38 MAPK.
25216681 Loss of RPS19 expression is associated with Diamond-Blackfan anemia.
25132370 RPS19 mutation is associated with Diamond Blackfan Anemia.
25069755 Mutations R62W and R101H impair RPS19 ability to associate with the ribosome.
25062117 A binding domain for RPS19 was identified and characterized in the N-terminus.
24875531 increase of autophagy in cells derived from DBA patients, in CD34+ erythrocyte progenitor cells with RPS19 knock down, in the red blood cells of zebrafish embryos with RP-deficiency, and in cells from patients with Shwachman-Diamond syndrome
24463277 levels of branched-chain aminotransferase-1 (BCAT1) transcripts are significantly decreased on the polysomes of both RPS19 and RPL11 cells and that translation of BCAT1 protein is especially impaired in cells with small RP gene mutations
22944692 Positional proteomics analysis identifies the cleavage of human ribosomal protein S19 (RPS19) at amino acid residues 105-106 by the HIV-1 protease
22833095 RPS19 mutations induced a decrease in proliferation of progenitor cells, but the terminal erythroid differentiation was normal with little or no apoptosis.
22689679 High frequency of RPS19 gene deletion is associated with Italian Diamond-Blackfan anemia.
More...

AA Sequence

MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGA      1 - 70
GVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLKMVEKDQDGGRKLTPQGQRDLDRIAGQVAA     71 - 140
ANKKH                                                                     141 - 145
//

Text Mined References (93)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25270909 2014 TNF-mediated inflammation represses GATA1 and activates p38 MAP kinase in RPS19-deficient hematopoietic progenitors.
25216681 2014 Gene therapy cures the anemia and lethal bone marrow failure in a mouse model of RPS19-deficient Diamond-Blackfan anemia.
25132370 2014 Clinical phenotype and genetic analysis of RPS19, RPL5, and RPL11 genes in Greek patients with Diamond Blackfan Anemia.
25069755 2014 Analysis of the interactome of ribosomal protein S19 mutants.
25062117 2014 Ribosomal protein S19-binding domain provides insights into hantavirus nucleocapsid protein-mediated translation initiation mechanism.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24875531 2014 Ribosomal protein mutations induce autophagy through S6 kinase inhibition of the insulin pathway.
24463277 2014 Translation of branched-chain aminotransferase-1 transcripts is impaired in cells haploinsufficient for ribosomal protein genes.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...