Property Summary

NCBI Gene PubMed Count 1,365
PubMed Score 3042.80
PubTator Score 3747.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 6.675 3.3
Ataxia telangiectasia 34 3.58 1.8
Adenoma 167 3.088 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.200 2.2e-08
acute quadriplegic myopathy 2.940 1.3e-09
astrocytoma 2.000 2.9e-02
autosomal dominant Emery-Dreifuss muscul... 1.883 7.3e-04
Duchenne muscular dystrophy 1.069 9.9e-06
ductal carcinoma in situ 1.200 3.1e-02
gastric cancer -1.100 1.1e-02
glioblastoma 2.500 6.7e-04
juvenile dermatomyositis 1.407 5.7e-08
limb girdle muscular dystrophy 2A 1.087 1.8e-04
lung cancer -2.500 3.1e-04
medulloblastoma, large-cell -1.300 6.2e-03
non diabetic and post-ischemic heart fai... -1.200 8.2e-03
oligodendroglioma 1.300 4.8e-03
osteosarcoma 1.333 1.9e-02
ovarian cancer 1.200 5.5e-03
pituitary cancer -2.300 5.5e-06
primary pancreatic ductal adenocarcinoma 1.172 1.9e-02
psoriasis -1.100 2.8e-06
subependymal giant cell astrocytoma 2.595 3.7e-03
tuberculosis -1.300 2.4e-02
type II diabetes mellitus and post-ische... -1.200 3.5e-02

 GWAS Trait (1)

Gene RIF (1298)

AA Sequence

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRG      1 - 70
LGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGR     71 - 140
KRRQTSMTDFYHSKRRLIFSKRKP                                                  141 - 164
//

Text Mined References (1372)

PMID Year Title