Property Summary

NCBI Gene PubMed Count 1,259
Grant Count 498
R01 Count 355
Funding $28,771,670.41
PubMed Score 2997.37
PubTator Score 3747.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P38936 Q14010 Q6FI05 Q9BUT4
Symbols P21
CIP1
SDI1
WAF1
CAP20
CDKN1
MDA-6
p21CIP1

Gene

PDB

1AXC   4RJF   5E0U   2ZVV   2ZVW  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463170 screening 0 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: luminescence-based cell-based assay to identify inhibitors of p21 (CDKN1A) degradation

Gene RIF (1205)

PMID Text
27156331 demonstrated that patients with the LMP-7 CA/AA genotypes were more likely to have advanced fibrosis scores than those bearing the CC genotype
27012093 these results demonstrate complex links between different signaling cascades in stressed hMESC, implicating ERK, p38 and JNK in regulation of the premature senescence via p53/p21/Rb pathway.
26986513 NORE1A expression appeared to contribute to mCD40L-induced cell death and enhance cell transition from G1 to S phase of the cell cycle in a p21-dependent mechanism.
26970274 prolactin activation of Stat5 results in the formation of a complex between phospho-Stat5 and BRCA1. Formation of this complex does not interfere with nuclear translocation or binding of BRCA1 to the p21 promoter
26940882 Estrogen-related receptor gamma is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26876176 Dynamics of CDKN1A in single cells has been defined defined by an endogenous fluorescent tagging.
26861625 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26832959 It was concluded that over-activation of the mTORC1/4E-BP1/p21 pathway is a frequent and clinically relevant alteration in head and neck squamous cell carcinomas.
26823785 results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer.
26754670 Study provides evidence that miR-208a can affect the proliferation and radio-sensitivity of human lung cancer cells by targeting p21.
More...

AA Sequence

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRG      1 - 70
LGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGR     71 - 140
KRRQTSMTDFYHSKRRLIFSKRKP                                                  141 - 164
//

Text Mined References (1265)

PMID Year Title
27156331 2016 SNP rs1059234 in CDKN1A Gene Correlates with Prognosis in Resected Gastric Adenocarcinoma.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27012093 2015 [RELATIONSHIP BETWEEN p53/p21/Rb AND MAPK SIGNALING PATHWAYS IN HUMAN ENDOMETRIUM-DERIVED STEM CELLS UNDER OXIDATIVE STRESS].
26986513 2016 NORE1A induction by membrane-bound CD40L (mCD40L) contributes to CD40L-induced cell death and G1 growth arrest in p21-mediated mechanism.
26970274 2016 Prolactin inhibits a major tumor-suppressive function of wild type BRCA1.
26940882 2016 Estrogen-related receptor ? is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26876176 2016 Dynamics of CDKN1A in Single Cells Defined by an Endogenous Fluorescent Tagging Toolkit.
26861625 2016 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26832959 2016 Stabilization of p21 by mTORC1/4E-BP1 predicts clinical outcome of head and neck cancers.
26823785 2015 Expression of CDKN1A/p21 and TGFBR2 in breast cancer and their prognostic significance.
More...