Property Summary

NCBI Gene PubMed Count 44
PubMed Score 79.92
PubTator Score 82.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
malignant mesothelioma 3232 1.3e-05
psoriasis 6694 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Muscular atrophy 71 5.818 2.9
Motor neuron disease 49 4.929 2.5

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 1.3e-05
psoriasis 1.200 1.6e-03

Protein-protein Interaction (7)

Gene RIF (27)

AA Sequence

MASAAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPR      1 - 70
RYGSAAALPSNSFTSGDIVGLYDAANEGSQLATGILTRVTQKSVTVAFDESHDFQLSLDRENSYRLLKLA     71 - 140
NDVTYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSPASEIHPLTFFNTCLDTSQKEAVLFALSQKELA    141 - 210
IIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALCKQRILRLGHPARLLESIQQHSL    211 - 280
DAVLARSDSAQIVADIRKDIDQVFVKNKKTQDKREKSNFRNEIKLLRKELKEREEAAMLESLTSANVVLA    281 - 350
TNTGASADGPLKLLPESYFDVVVIDECAQALEASCWIPLLKARKCILAGDHKQLPPTTVSHKAALAGLSL    351 - 420
SLMERLAEEYGARVVRTLTVQYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLL    421 - 490
VDTAGCGLFELEEEDEQSKGNPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQVDLLRQSLVHRHPELE    491 - 560
IKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYF    561 - 630
TQHGEVRTAFEYLDDIVPENYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGK    631 - 700
SLASEAPSQPSLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHD    701 - 770
SSGEGKRRFITVSKRAPRPRAALGPPAGTGGPAPLQPVPPTPAQTEQPPREQRGPDQPDLRTLHLERLQR    771 - 840
VRSAQGQPASKEQQASGQQKLPEKKKKKAKGHPATDLPTEEDFEALVSAAVKADNTCGFAKCTAGVTTLG    841 - 910
QFCQLCSRRYCLSHHLPEIHGCGERARAHARQRISREGVLYAGSGTKNGSLDPAKRAQLQRRLDKKLSEL    911 - 980
SNQRTSRRKERGT                                                             981 - 993
//

Text Mined References (51)

PMID Year Title