Property Summary

NCBI Gene PubMed Count 120
Grant Count 63
R01 Count 36
Funding $8,659,391.19
PubMed Score 441.15
PubTator Score 183.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P38646 B2RCM1 P30036 P31932 Q1HB43 Q53H23 Q6GU03 Q9BWB7 Q9UC56
Symbols CSA
MOT
MOT2
SAAN
CRP40
EVPLS
GRP75
PBP74
GRP-75
HSPA9B
SIDBA4
MTHSP75
HEL-S-124m

Gene

PANTHER Protein Class (2)

PDB

3N8E   4KBO  

Gene RIF (90)

PMID Text
26955804 Study shows that Mortalin is upregulated in breast cancer, and may be a useful poor prognostic biomarker for patients with breast cancer.
26702583 Thus Hspa9 regulates erythroid differentiation through ISC cluster assembly, providing a pathophysiological mechanism for an MDS subtype characterized by HSPA9 haploinsufficiency
26598328 Biallelic mutations in HSPA9 are associated with the EVEN-PLUS syndrome of congenital malformations and skeletal dysplasia.
26491070 mutations in HSPA9 result in congenital sideroblastic anemia inherited as an autosomal recessive trait
26188124 veratridine enhances transactivation of UBXN2A, resulting in upregulation of UBXN2A in the cytoplasm, where UBXN2A binds and inhibits the oncoprotein mortalin-2
26095919 This study showed that human post-mortem tissue indicated co-localization of mortalin within astrocytes.
25904328 Impaired stoichiometry between mtHsp40 and mtHsp70 promotes Opa1L cleavage, leading to cristae opening, decreased OXPHOS, and triggering of mitochondrial fragmentation after reduction in their chaperone function.
25665531 Expression of mortalin decreased significantly in dopaminergic cells overexpressing A53T alpha-syn
25645922 Human mot-1, R126W, or P509S mutants lack mot-2 functions involved in carcinogenesis.
25615450 Results present the functional structure of human mortalin showing at least two domains and interacts with adenosine nucleotides with high affinity depending on the presence of Mg2+ ions.
More...

AA Sequence

MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVM      1 - 70
EGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNV     71 - 140
PFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQ    141 - 210
ISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQ    211 - 280
ALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQ    281 - 350
FEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG    351 - 420
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGE    421 - 490
REMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIEN    491 - 560
MVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETG    561 - 630
ENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ                         631 - 679
//

Text Mined References (132)

PMID Year Title
26955804 2016 The clinicopathological significance of Mortalin overexpression in invasive ductal carcinoma of breast.
26702583 2016 Mitochondrial Hspa9/Mortalin regulates erythroid differentiation via iron-sulfur cluster assembly.
26598328 2015 Mutations in the heat-shock protein A9 (HSPA9) gene cause the EVEN-PLUS syndrome of congenital malformations and skeletal dysplasia.
26491070 2015 Congenital sideroblastic anemia due to mutations in the mitochondrial HSP70 homologue HSPA9.
26188124 2015 A plant alkaloid, veratridine, potentiates cancer chemosensitivity by UBXN2A-dependent inhibition of an oncoprotein, mortalin-2.
26095919 2016 Mortalin is Expressed by Astrocytes and Decreased in the Midbrain of Parkinson's Disease Patients.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25904328 2015 Stoichiometric expression of mtHsp40 and mtHsp70 modulates mitochondrial morphology and cristae structure via Opa1L cleavage.
25665531 2015 Involvement of mortalin/GRP75/mthsp70 in the mitochondrial impairments induced by A53T mutant ?-synuclein.
25645922 2015 Functional significance of point mutations in stress chaperone mortalin and their relevance to Parkinson disease.
More...