Property Summary

NCBI Gene PubMed Count 135
PubMed Score 580.43
PubTator Score 183.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 1.0e-02
lung adenocarcinoma 1.226 9.4e-09
lung cancer 1.100 3.0e-02
Multiple myeloma 2.320 2.4e-05
osteosarcoma -1.200 5.5e-03
ovarian cancer 1.100 1.8e-03
pancreatic ductal adenocarcinoma liver m... -1.388 1.9e-02
tuberculosis and treatment for 6 months 1.400 3.1e-05
Waldenstrons macroglobulinemia 1.485 8.4e-03

Protein-protein Interaction (5)

Gene RIF (96)

AA Sequence

MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVM      1 - 70
EGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNV     71 - 140
PFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQ    141 - 210
ISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQ    211 - 280
ALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQ    281 - 350
FEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG    351 - 420
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGE    421 - 490
REMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIEN    491 - 560
MVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETG    561 - 630
ENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ                         631 - 679
//

Text Mined References (147)

PMID Year Title