Property Summary

NCBI Gene PubMed Count 34
PubMed Score 64.69
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.500 0.004
ependymoma -1.300 0.005
glioblastoma -1.800 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 3.834 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
acute quadriplegic myopathy 1.202 0.000
sonic hedgehog group medulloblastoma -1.100 0.000
psoriasis 1.100 0.002
lung carcinoma 1.100 0.000
Pick disease -1.100 0.005
ovarian cancer -1.200 0.000
Gaucher disease type 1 -1.100 0.035
Bipolar Disorder -1.800 0.043

Synonym

Accession P38606 B2RBR8 B7Z1R5 D3DN75 Q53YD9 Q96DY6 Q9UHY3 V-ATPase subunit A
Symbols HO68
VA68
VPP2
Vma1
ATP6A1
ATP6V1A1

Gene

Gene RIF (6)

PMID Text
25652905 V1A subunit of V-ATPase has a role in the progression and prognosis of gastric cancer.
22561749 Data show that the cAMP/PKA/CREB signaling pathway initiates acidosis-induced V-ATPase trafficking in salivary ducts via regulation of Rab11b expression.
20717956 These data introduce Rab11b as a crucial regulator and Rip11 as mediator of acidosis-induced V-ATPase traffic in duct cells of submandibular gland.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
17576770 there is an important role for physical association between aldolase and the A, B and E subunits of V-ATPase in the regulation of the proton pump

AA Sequence

MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEET      1 - 70
SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKN     71 - 140
LRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTMVQVWP    141 - 210
VRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGER    211 - 280
GNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADS    281 - 350
TSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP    351 - 420
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLA    421 - 490
EIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQ    491 - 560
SDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED                 561 - 617
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25652905 2015 Expression and role of V1A subunit of V-ATPases in gastric cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22561749 2012 Acidosis-induced V-ATPase trafficking in salivary ducts is initiated by cAMP/PKA/CREB pathway via regulation of Rab11b expression.
More...