Property Summary

NCBI Gene PubMed Count 36
PubMed Score 66.38
PubTator Score 8.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.202 2.2e-07
astrocytic glioma -1.300 3.5e-03
atypical teratoid / rhabdoid tumor -1.200 8.1e-07
Bipolar Disorder -1.800 4.3e-02
ependymoma -1.300 4.6e-03
Gaucher disease type 1 -1.100 3.5e-02
glioblastoma -1.800 3.0e-04
lung carcinoma 1.100 5.9e-19
oligodendroglioma -1.200 7.1e-08
osteosarcoma 3.834 3.1e-05
ovarian cancer -1.200 3.0e-04
Pick disease -1.100 5.4e-03
psoriasis 1.100 2.1e-03
sonic hedgehog group medulloblastoma -1.100 2.1e-05

Gene RIF (7)

AA Sequence

MDFSKLPKILDEDKESTFGYVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEET      1 - 70
SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRDIKWDFTPCKN     71 - 140
LRVGSHITGGDIYGIVSENSLIKHKIMLPPRNRGTVTYIAPPGNYDTSDVVLELEFEGVKEKFTMVQVWP    141 - 210
VRQVRPVTEKLPANHPLLTGQRVLDALFPCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGER    211 - 280
GNEMSEVLRDFPELTMEVDGKVESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDMGYHVSMMADS    281 - 350
TSRWAEALREISGRLAEMPADSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDP    351 - 420
VTSATLGIVQVFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLA    421 - 490
EIVQLVGKASLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQ    491 - 560
SDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED                 561 - 617
//

Text Mined References (43)

PMID Year Title