Property Summary

Ligand Count 8
NCBI Gene PubMed Count 60
PubMed Score 616.32
PubTator Score 409.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Obesity 678 0.0 0.8
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.679 1.8
Disease Target Count
Wolman disease 6

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 2.055 2.9e-03
active ulcerative colitis 1.782 2.5e-03
adult high grade glioma -1.300 7.8e-05
astrocytic glioma -1.900 3.8e-03
Astrocytoma, Pilocytic -1.600 1.9e-10
atypical teratoid / rhabdoid tumor -1.700 9.9e-08
Breast cancer 2.900 4.0e-02
breast carcinoma 1.200 1.3e-02
diabetes mellitus -1.300 4.5e-02
Down syndrome 1.400 1.1e-03
Duchenne muscular dystrophy 1.768 3.1e-10
ependymoma -2.300 4.3e-03
glioblastoma -1.300 7.1e-08
group 3 medulloblastoma -1.300 3.1e-03
interstitial cystitis 1.100 2.6e-02
juvenile dermatomyositis 1.114 1.1e-07
lung cancer -1.700 3.0e-05
medulloblastoma, large-cell -1.600 8.9e-05
Multiple myeloma 1.402 1.3e-03
osteosarcoma -1.078 1.6e-02
ovarian cancer -3.800 5.3e-13
pituitary cancer 1.800 1.1e-05
primary Sjogren syndrome 1.600 3.4e-03
primitive neuroectodermal tumor -1.200 5.9e-03
subependymal giant cell astrocytoma -1.168 4.8e-02
tuberculosis 1.400 5.5e-07
Waldenstrons macroglobulinemia 1.374 1.1e-02

Gene RIF (37)

AA Sequence

MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR      1 - 70
KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW     71 - 140
AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT    141 - 210
SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY    211 - 280
TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV    281 - 350
YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ                         351 - 399
//

Text Mined References (62)

PMID Year Title