Property Summary

NCBI Gene PubMed Count 20
Grant Count 18
R01 Count 8
Funding $2,470,697.95
PubMed Score 166.43
PubTator Score 71.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (6)

PMID Text
24778442 results indicate that neither rHuPH20 nor its directly generated HA catabolites have inflammatory properties in the air pouch model, and rHuPH20 can instead inhibit some aspects of inflammation, such as neutrophil infiltration into the air pouch.
23463525 PH20 is elevated in demyelinating lesions and that increased PH20 expression is sufficient to inhibit oligodendrocyte precursor cell maturation and remyelination.
23247813 HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition, such as arylsulfatase A and SPAM1.
23209833 The interaction between SPAM1, ARSA and HSPA2 in a multimeric complex mediating sperm-egg interaction.
20634891 Observational study of gene-disease association. (HuGE Navigator)
12932297 SPAM1 mRNA & protein occur in all 3 regions of epididymis & vas deferens. It has hyaluronidase activity at pH 7.0. The proximal promoter has epididymal transcription factor sites including androgen receptor elements. Its role may be in sperm maturation.

AA Sequence

MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFCLGKFDEPLDM      1 - 70
SLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISLQDHLDKAKKDITFYMPVDNL     71 - 140
GMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLL    141 - 210
RPNHLWGYYLFPDCYNHHYKKPGYNGSCFNVEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRN    211 - 280
RVREAIRVSKIPDAKSPLPVFAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKS    281 - 350
CLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK    351 - 420
PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQIFYNASPSTLS    421 - 490
ATMFIVSILFLIISSVASL                                                       491 - 509
//

Text Mined References (23)

PMID Year Title
24778442 2014 Recombinant human hyaluronidase PH20 does not stimulate an acute inflammatory response and inhibits lipopolysaccharide-induced neutrophil recruitment in the air pouch model of inflammation.
23463525 2013 Digestion products of the PH20 hyaluronidase inhibit remyelination.
23247813 2013 Investigation of the mechanisms by which the molecular chaperone HSPA2 regulates the expression of sperm surface receptors involved in human sperm-oocyte recognition.
23209833 2012 The molecular chaperone HSPA2 plays a key role in regulating the expression of sperm surface receptors that mediate sperm-egg recognition.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15804358 2005 Transcription of the human and rodent SPAM1 / PH-20 genes initiates within an ancient endogenous retrovirus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12932297 2003 SPAM1 (PH-20) protein and mRNA expression in the epididymides of humans and macaques: utilizing laser microdissection/RT-PCR.
More...