Property Summary

NCBI Gene PubMed Count 90
PubMed Score 44.19
PubTator Score 184.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.100 6.4e-04
Multiple Sclerosis 1.300 4.3e-04
osteosarcoma 1.057 7.6e-04
pituitary cancer -1.100 2.3e-07

Protein-protein Interaction (1)

Gene RIF (77)

AA Sequence

MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT      1 - 70
DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV     71 - 140
GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL    141 - 210
QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW    211 - 280
FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL                 281 - 337
//

Text Mined References (95)

PMID Year Title