Property Summary

NCBI Gene PubMed Count 86
Grant Count 13
R01 Count 10
Funding $645,397.42
PubMed Score 41.78
PubTator Score 184.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.057 0.001
glioblastoma 1.100 0.001
Multiple Sclerosis 1.300 0.000
pituitary cancer -1.100 0.000

Gene RIF (73)

PMID Text
26601495 The variability of potentially important functional polymorphic variants of the IFNG, IFNGR2 and NEIL2 genes was characterized in representatives of four ethnic groups living in the Siberian region.
25815589 Statistical analyses revealed that four genetic variants in IFNGR1 were marginally associated with the risk of Tuberculosis (P = 0.02-0.04), while other single nucleotide polymorphisms in IFNGR1 and IFNGR2 did not exhibit any associations
25708927 The expression of IFNGR2 was significantly higher in patients with RA compared with control subjects and was significantly higher in patients in whom radiographic damage was more severe.
25592983 Fatal hemophagocytic lymphohistiocytosis has been described in two unrelated pediatric patients with underlying IFNGR2 deficiency.
25301852 This is the first study that shows an association between SNPs and liver fibrosis in the general population
23980639 It related to persistence of hepatitis B virus (HBV) infection and viral load in chronic HBV.
23963039 We report a molecular study of the two known patients with autosomal recessive, partial interferon-gamma receptor (IFN-gammaR)2 deficiency
23459074 IFN-gammaR2-deficient monocytes induce a higher percentage of IL-17(+) cells from both healthy and IFN-gammaR2-deficient CD4(+) T cells.
23161749 IFNGR2 haploinsufficiency may underlie clinical tuberculosis in children living in areas of endemic disease.
22219326 JAK2 is a critical factor that stabilizes IFN-gammaR2 surface expression in Th17 cells from AMS patients, making them sensitive to IFN-gamma.
More...

AA Sequence

MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT      1 - 70
DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV     71 - 140
GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL    141 - 210
QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW    211 - 280
FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL                 281 - 337
//

Text Mined References (91)

PMID Year Title
26601495 2015 [Characteristic of the Genetic Variability of Four Polymorphic Variants (rs2069705, rs17880053, rs11126176, and rs804271) in Representative Samples of Indigenous and Alien Populations of Siberia].
25815589 2015 Association study of polymorphisms in interferon-? receptor genes with the risk of pulmonary tuberculosis.
25708927 2015 Expression of Interferon-? Receptor Genes in Peripheral Blood Mononuclear Cells Is Associated With Rheumatoid Arthritis and Its Radiographic Severity in African Americans.
25592983 2015 Hemophagocytic lymphohistiocytosis in 2 patients with underlying IFN-? receptor deficiency.
25301852 2015 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in the general population: the Rotterdam Study.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23980639 2014 HLA-DP and ?-interferon receptor-2 gene variants and their association with viral hepatitis activity in chronic hepatitis B infection.
23963039 2013 Partial IFN-?R2 deficiency is due to protein misfolding and can be rescued by inhibitors of glycosylation.
23459074 2013 Influence of a mutation in IFN-? receptor 2 (IFNGR2) in human cells on the generation of Th17 cells in memory T cells.
More...