Property Summary

NCBI Gene PubMed Count 86
Grant Count 32
R01 Count 22
Funding $4,032,513.01
PubMed Score 72.75
PubTator Score 108.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

 GWAS Trait (1)

Gene RIF (67)

PMID Text
26751406 529 adults (n = 325 European-Americans, 204 Egyptians) on a stable warfarin dose were genotyped for GGCX rs12714145 and rs10654848, FPGS rs7856096, and STX1B rs4889606.
25151188 Detected are ten mutations in the gamma-glutamyl carboxylase gene in patients with hereditary deficiency of vitamin K-dependent coagulation factors.
25042728 GGCX c.2084+45G polymorphisms has a moderate effect on VKAs dose requirements in Slavic population from Central-Eastern Europe.
24927344 The allele frequency for GGCX 12970 C > G is 1.43 in north Indians and did not have a significant bearing on the maintenance dose of acenocoumarol oral anticoagulant in cardiac valve replacement patients.
24739904 GGCX mutation found in families with pseudoxanthoma elasticum with retinitis pigmentosa and cutis laxa.
24231026 study demonstrated the effects of SNP (974G>A) in the GGCX gene on the correlation between dietary vitamin K intake and gamma-carboxylation of serum osteocalcin
24148610 In atrial fibrillation population in Xinjiang, patients with CT and TT genotypes in the gamma-glutamyl carboxylase gene rs259251 loci required significantly higher warfarin dose than those with CC genotype.
23941071 These findings indicate that individuals carrying the CYP2C19 rs3814637CC or CYP2C9 rs1057910AA or GGCX rs699664AA genotype needed higher warfarin doses in the Chinese population.
23817635 evaluation of urinary Gla excretion in relation with apo E genotype
22188360 Quantitative PCR assays for VKORC1, CYP4F2, GGCX and CALU identified two copies in all populations.
More...

AA Sequence

MAVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFL      1 - 70
FGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCV     71 - 140
LFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIV    141 - 210
YFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGL    211 - 280
FFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRG    281 - 350
KSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRT    351 - 420
GELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQ    421 - 490
AAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEV    491 - 560
TVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSE    561 - 630
TGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTC    631 - 700
ISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF                701 - 758
//

Text Mined References (93)

PMID Year Title
26751406 2016 Impact of GGCX, STX1B and FPGS Polymorphisms on Warfarin Dose Requirements in European-Americans and Egyptians.
25151188 2014 Bleeding and non-bleeding phenotypes in patients with GGCX gene mutations.
25042728 2014 Genetic determinants of acenocoumarol and warfarin maintenance dose requirements in Slavic population: a potential role of CYP4F2 and GGCX polymorphisms.
24927344 2014 CYP4F2 1347 G > A & GGCX 12970 C > G polymorphisms: frequency in north Indians & their effect on dosing of acenocoumarol oral anticoagulant.
24739904 2014 Retinitis pigmentosa, cutis laxa, and pseudoxanthoma elasticum-like skin manifestations associated with GGCX mutations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24231026 2013 Effects of gamma-glutamyl carboxylase gene polymorphism (R325Q) on the association between dietary vitamin K intake and gamma-carboxylation of osteocalcin in young adults.
24148610 2013 Association of GGCX gene polymorphism with warfarin dose in atrial fibrillation population in Xinjiang.
23941071 2013 Association of genetic polymorphisms with warfarin dose requirements in Chinese patients.
23817635 2013 Apolipoprotein E genotype may influence urinary gammacarboxyglutamate (Gla) concentrations in young individuals.
More...