Property Summary

Ligand Count 1
NCBI Gene PubMed Count 88
PubMed Score 79.33
PubTator Score 108.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma 1.700 5.8e-03
atypical teratoid / rhabdoid tumor -1.100 3.0e-03
ependymoma 1.200 1.9e-12
gastric cancer 1.100 6.9e-03
glioblastoma 1.200 6.4e-05
group 3 medulloblastoma 1.200 3.3e-02
invasive ductal carcinoma 1.100 1.4e-02
lung adenocarcinoma 1.363 2.1e-04
lung cancer 1.800 3.3e-02
medulloblastoma, large-cell -1.600 1.7e-04
Multiple myeloma 1.205 9.4e-03
non-small cell lung cancer 1.040 2.7e-09
osteosarcoma -5.501 3.5e-12
ovarian cancer 2.100 7.6e-05
pancreatic cancer 1.100 5.8e-03
pancreatic carcinoma 1.100 5.8e-03
pancreatic ductal adenocarcinoma liver m... -2.416 1.2e-03
psoriasis -6.400 3.3e-06
tuberculosis and treatment for 6 months -1.100 2.7e-05
Waldenstrons macroglobulinemia 1.160 1.7e-02

Gene RIF (69)

AA Sequence

MAVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFL      1 - 70
FGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCV     71 - 140
LFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIV    141 - 210
YFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGL    211 - 280
FFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRG    281 - 350
KSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRT    351 - 420
GELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQ    421 - 490
AAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEV    491 - 560
TVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSE    561 - 630
TGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTC    631 - 700
ISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF                701 - 758
//

Text Mined References (95)

PMID Year Title