Property Summary

NCBI Gene PubMed Count 41
PubMed Score 31.95
PubTator Score 44.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -2.900 3.0e-06
astrocytic glioma -1.200 3.1e-02
Atopic dermatitis -1.200 9.3e-04
atypical teratoid / rhabdoid tumor -1.700 2.6e-02
Breast cancer -2.800 6.5e-40
breast carcinoma -1.200 6.4e-33
colon cancer -1.200 5.0e-03
ductal carcinoma in situ -1.400 2.7e-04
ependymoma -2.000 3.2e-02
glioblastoma -2.000 2.8e-04
group 3 medulloblastoma -3.500 8.9e-06
invasive ductal carcinoma -2.100 5.8e-04
malignant mesothelioma 2.200 1.4e-06
medulloblastoma, large-cell -3.300 4.1e-06
nasopharyngeal carcinoma -1.300 5.5e-06
oligodendroglioma -1.100 1.0e-05
osteosarcoma -1.584 3.0e-02
ovarian cancer -1.400 1.4e-04
Pick disease -1.200 1.9e-03
pituitary cancer -2.100 1.6e-03
psoriasis -1.300 3.9e-05
urothelial carcinoma -1.300 2.3e-02

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (27)

AA Sequence

MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGF      1 - 70
NPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKL     71 - 140
WDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFD    141 - 210
VGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNK    211 - 280
QDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHF    281 - 350
TCAVDTENIRRVFNDCRDIIQRMHLKQYELL                                           351 - 381
//

Text Mined References (42)

PMID Year Title