Property Summary

Ligand Count 4
NCBI Gene PubMed Count 2,445
PubMed Score 6081.28
PubTator Score 6429.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.5
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 7.466 3.7

Expression

  Differential Expression (14)

Disease log2 FC p
lung cancer 1.700 1.5e-03
colon cancer 1.300 1.6e-02
glioblastoma 1.300 4.4e-06
group 3 medulloblastoma 2.500 6.3e-07
intraductal papillary-mucinous carcinoma... 1.300 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.9e-03
lung adenocarcinoma 1.100 1.4e-06
malignant mesothelioma 2.300 4.6e-07
medulloblastoma, large-cell 1.700 1.3e-05
nasopharyngeal carcinoma 1.300 6.0e-06
non-small cell lung cancer 1.262 2.3e-16
osteosarcoma -1.411 1.5e-02
posterior fossa group A ependymoma 1.100 7.5e-06
primitive neuroectodermal tumor 1.800 2.3e-04

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (27)

Gene RIF (2456)

AA Sequence

MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITK      1 - 70
RSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQS     71 - 140
EPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQ    141 - 210
GTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHA    211 - 280
SSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCER    281 - 350
KEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVD    351 - 420
EYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEP    421 - 490
QIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGD    491 - 560
SIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRN    561 - 630
LSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPEL    631 - 700
KLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSIS    701 - 770
LVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHS    771 - 840
RETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQ    841 - 910
GKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRI    911 - 980
PPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSS    981 - 1050
TNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTV   1051 - 1120
NTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSP   1121 - 1190
SPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENL   1191 - 1260
LSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSES   1261 - 1330
QGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTM   1331 - 1400
QHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPE   1401 - 1470
GLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLE   1471 - 1540
ESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAES   1541 - 1610
AQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLI   1611 - 1680
TEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPK   1681 - 1750
RARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNG   1751 - 1820
FHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY                              1821 - 1863
//

Text Mined References (2467)

PMID Year Title