Property Summary

NCBI Gene PubMed Count 53
PubMed Score 35.81
PubTator Score 22.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Orofaciodigital syndrome, Shashi type 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Intellectual disability 1016 0.0 4.0
Disease Target Count Z-score Confidence
Azoospermia 110 3.424 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.058 3.0e-04
adult high grade glioma 1.500 2.7e-03
astrocytic glioma 2.000 2.6e-02
atypical teratoid / rhabdoid tumor 2.000 4.6e-07
ependymoma 1.300 5.5e-06
glioblastoma 1.800 5.2e-08
group 3 medulloblastoma 3.000 1.5e-04
medulloblastoma, large-cell 2.100 6.8e-07
nasopharyngeal carcinoma 1.100 1.7e-04
oligodendroglioma 1.800 4.1e-02
osteosarcoma 4.375 5.8e-10
ovarian cancer -2.600 5.1e-09
Pick disease 1.400 9.6e-05
primitive neuroectodermal tumor 1.600 2.0e-05
progressive supranuclear palsy -1.500 1.2e-02

Gene RIF (14)

AA Sequence

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN      1 - 70
GKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNM     71 - 140
SSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPR    141 - 210
DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGS    211 - 280
YRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLP    281 - 350
PSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY                                 351 - 391
//

Text Mined References (67)

PMID Year Title