Property Summary

NCBI Gene PubMed Count 50
PubMed Score 32.85
PubTator Score 22.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
osteosarcoma 7933 5.80108440066506E-10
ovarian cancer 8492 5.05037631843845E-9
glioblastoma 5572 5.17348981418975E-8
atypical teratoid / rhabdoid tumor 4369 4.59773124035416E-7
ependymoma 2514 5.51303086849539E-6
Pick disease 1893 8.42386165828893E-6
medulloblastoma, large-cell 6234 1.120299841409E-5
primitive neuroectodermal tumor 3031 3.63100220154099E-5
group 3 medulloblastoma 2254 1.5253943925323E-4
nasopharyngeal carcinoma 1056 1.65651235464857E-4
pediatric high grade glioma 2712 2.84432470168021E-4
acute quadriplegic myopathy 1157 2.98851433733259E-4
progressive supranuclear palsy 674 0.0116827632547739
astrocytic glioma 2241 0.0259854665267704
oligodendroglioma 2849 0.0411895010559421
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Azoospermia 89 3.441 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 2.000 0.026
oligodendroglioma 1.800 0.041
glioblastoma 1.800 0.000
osteosarcoma 4.375 0.000
ependymoma 1.300 0.000
group 3 medulloblastoma 3.000 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 2.100 0.000
acute quadriplegic myopathy 1.058 0.000
pediatric high grade glioma 1.500 0.000
nasopharyngeal carcinoma 1.100 0.000
Pick disease -1.600 0.000
progressive supranuclear palsy -1.500 0.012
ovarian cancer -2.600 0.000

Synonym

Accession P38159 B4E3U4 D3DWH0 E9PG86 Q5JQ67 Q8N8Y7 Q969R3
Symbols RNMX
HNRPG
HNRNPG
MRXS11
RBMXP1
RBMXRT
hnRNP-G

Gene

PDB

2MB0   2MKS  

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (13)

PMID Text
26333388 Host RBMX is required for the maintenance of Borna disease virus nuclear viral factories.
25884434 Results showed that HNRNPG and HTRA2-BETA1 were specific antagonistic regulators of ERa exon7 splicing and increased HNRNPG levels were associated with improved clinical outcome of endometrial cancer through up-regulation of ERaD7 expression.
25256757 A sequence deletion within RBMX is identified as associated with with Shashi X-linked intellectual disability syndrome.
23125841 Tandem affinity purification and mass spectrometry analysis identify X-linked RNA binding motif protein (RBMX; hnRNP-G), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22832223 RBMX is a cohesion regulator that maintains the proper cohesion of sister chromatids.
22344029 Data show that RBMX accumulated at DNA lesions through multiple domains in a poly(ADP-ribose) polymerase 1-dependent manner and promoted HR by facilitating proper BRCA2 expression.
21840245 studied the genetic and expression states of hnRNP G in normal, premalignant and malignant human oral tissues to further understand the relationship between the hnRNP G alterations and the development of human oral cancer
18541147 These studies indicate that hnRNP G promotes the expression of Txnip and mediates its tumor-suppressive effect.
18445477 This identifies RBMX as an ARTS-1-associated protein that regulates both the constitutive release of TNFR1 exosome-like vesicles and the inducible proteolytic cleavage of TNFR1 ectodomains.
17387044 p53 modulates DNA DSB repair by, in part, inducing hnRNP G
More...

AA Sequence

MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMN      1 - 70
GKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNM     71 - 140
SSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRREPLPSRRDVYLSPR    141 - 210
DDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGS    211 - 280
YRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLP    281 - 350
PSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY                                 351 - 391
//

Text Mined References (63)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26333388 2015 X-linked RNA-binding motif protein (RBMX) is required for the maintenance of Borna disease virus nuclear viral factories.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884434 2015 HNRNP G and HTRA2-BETA1 regulate estrogen receptor alpha expression with potential impact on endometrial cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25256757 2015 The RBMX gene as a candidate for the Shashi X-linked intellectual disability syndrome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...