Property Summary

NCBI Gene PubMed Count 26
PubMed Score 19.32
PubTator Score 25.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.204 0.004
group 4 medulloblastoma -1.800 0.000
pancreatic ductal adenocarcinoma liver m... -1.302 0.028
breast carcinoma -1.100 0.002
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -1.300 0.007
ulcerative colitis -1.100 0.000

Synonym

Accession P38117 A8K766 B3KNY2 Q6IBH7 Q71RF6 Q9Y3S7 Beta-ETF
Symbols MADD
FP585

Gene

PANTHER Protein Class (2)

PDB

1EFV   1T9G   2A1T   2A1U  

 GO Function (1)

Gene RIF (16)

PMID Text
25915519 Electron Transfer Flavoprotein Subunit Beta Is a Candidate Endothelial Cell Autoantigen in Behcet's Disease
25416781 Human METTL20 is a mitochondrial lysine methyltransferase that targets ETFbeta and modulates its activity.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of electron-transfer-flavoprotein, beta polypeptide (ETFB) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of electron-transfer-flavoprotein, beta polypeptide (ETFB) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of electron-transfer-flavoprotein, beta polypeptide (ETFB) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of electron-transfer-flavoprotein, beta polypeptide (ETFB) expression by HIV-1 Vpr in Vpr transduced macrophages
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of electron-transfer-flavoprotein, beta polypeptide (ETFB) expression by HIV-1 Vpr in Vpr transduced macrophages
23068445 ETFB knockdown can affect TGF-beta-induced tissue remodeling and/or fibrotic processes in vitro.
22588007 Point mutations in electron-transfer-flavoprotein beta is associated with destabilized conformations and defective protein:protein interactions leading to mitochondrial dysfunction.
21903359 ETFB participates in the mechanoregulation of fibroblast cell number in collagen gel culture.
More...

AA Sequence

MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQ      1 - 70
CQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAG     71 - 140
FLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIK    141 - 210
PGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI                             211 - 255
//

Text Mined References (32)

PMID Year Title
27499296 2016 Mitochondrial Protein Interaction Mapping Identifies Regulators of Respiratory Chain Function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915519 2015 Electron Transfer Flavoprotein Subunit Beta Is a Candidate Endothelial Cell Autoantigen in Behçet's Disease.
25416781 2015 Human METTL20 is a mitochondrial lysine methyltransferase that targets the ? subunit of electron transfer flavoprotein (ETF?) and modulates its activity.
25023281 2014 Human METTL20 methylates lysine residues adjacent to the recognition loop of the electron transfer flavoprotein in mitochondria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23068445 2012 Knockdown of electron transfer flavoprotein ? subunit reduced TGF-?-induced ?-SMA mRNA expression but not COL1A1 in fibroblast-populated three-dimensional collagen gel cultures.
22588007 2012 Mechanism of superoxide and hydrogen peroxide generation by human electron-transfer flavoprotein and pathological variants.
More...