Property Summary

NCBI Gene PubMed Count 28
PubMed Score 26.09
PubTator Score 25.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Multiple Acyl Coenzyme A Dehydrogenase Deficiency 3 0.0 0.0
Disease Target Count Z-score Confidence
Amino acid metabolic disorder 5 0.0 4.0

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -1.100 1.8e-03
ductal carcinoma in situ -1.300 5.5e-04
group 4 medulloblastoma -1.800 2.8e-06
invasive ductal carcinoma -1.300 6.9e-03
osteosarcoma -1.204 4.3e-03
pancreatic ductal adenocarcinoma liver m... -1.302 2.8e-02
ulcerative colitis -1.100 8.2e-06

 OMIM Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (15)

AA Sequence

MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQ      1 - 70
CQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAG     71 - 140
FLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIK    141 - 210
PGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI                             211 - 255
//

Text Mined References (35)

PMID Year Title