Property Summary

NCBI Gene PubMed Count 1,251
PubMed Score 3997.26
PubTator Score 4085.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
Breast cancer 3099 9.96617144034344E-23
ovarian cancer 8492 1.61604808687268E-17
non-small cell lung carcinoma 413 2.61166614955016E-12
atypical teratoid / rhabdoid tumor 4369 4.16141511329786E-12
lung adenocarcinoma 2714 1.45458331244736E-11
pediatric high grade glioma 2712 1.92730173330955E-9
malignant mesothelioma 3163 5.22148527086687E-9
glioblastoma 5572 9.70402193769502E-9
medulloblastoma 1524 3.02430143208281E-8
medulloblastoma, large-cell 6234 4.49999954110864E-8
urothelial carcinoma 318 8.20162953912217E-7
pilocytic astrocytoma 3086 1.14845962465094E-4
psoriasis 6685 1.3465662776743E-4
primitive neuroectodermal tumor 3031 1.99588379237682E-4
pancreatic carcinoma 567 2.82994371340705E-4
pancreatic cancer 2300 2.82994371340707E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.20358919197962E-4
breast carcinoma 1614 4.54204008453555E-4
osteosarcoma 7933 5.98879881295508E-4
tuberculosis 1563 8.5077721263144E-4
astrocytic glioma 2241 0.00150108882983373
ependymoma 2514 0.00198802544900371
head and neck cancer and chronic obstructive pulmonary disease 237 0.00273217298839006
Pick disease 1893 0.00379939555018834
cutaneous lupus erythematosus 1056 0.00448752551348885
oligodendroglioma 2849 0.0111595084779757
lung cancer 4473 0.0119604737674933
non primary Sjogren syndrome sicca 840 0.0210562962494288
colon cancer 1475 0.0408066030677567
invasive ductal carcinoma 2950 0.0430699768293997
Disease Target Count Z-score Confidence
Parkinson's disease 364 8.23 4.0
Disease Target Count Z-score Confidence
Multiple system atrophy 27 7.023 3.5
Disease Target Count Z-score Confidence
Alzheimer's disease 644 5.439 2.7
Disease Target Count
Dementia Lewy body 1
Parkinson disease 4 1

Expression

  Differential Expression (30)

Disease log2 FC p
pancreatic cancer 1.600 0.000
urothelial carcinoma -1.800 0.000
malignant mesothelioma -4.600 0.000
astrocytic glioma -4.200 0.002
ependymoma -4.500 0.002
oligodendroglioma -3.300 0.011
cutaneous lupus erythematosus -1.300 0.004
psoriasis -1.500 0.000
glioblastoma -5.400 0.000
osteosarcoma -4.414 0.001
medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -5.500 0.000
medulloblastoma, large-cell -5.900 0.000
primitive neuroectodermal tumor -3.500 0.000
tuberculosis 1.600 0.001
intraductal papillary-mucinous adenoma (... -1.100 0.000
lung cancer -2.100 0.012
colon cancer -1.400 0.041
breast carcinoma -1.200 0.000
pediatric high grade glioma -4.500 0.000
pilocytic astrocytoma -2.200 0.000
non primary Sjogren syndrome sicca 1.100 0.021
pancreatic carcinoma 1.600 0.000
lung adenocarcinoma -1.300 0.000
Breast cancer -1.700 0.000
non-small cell lung carcinoma -1.100 0.000
Pick disease -1.900 0.004
invasive ductal carcinoma -1.100 0.043
ovarian cancer -4.000 0.000
head and neck cancer and chronic obstruc... -1.200 0.003

Synonym

Accession P37840 A8K2A4 Q13701 Q4JHI3 Q6IAU6
Symbols PD1
NACP
PARK1
PARK4

Gene

PANTHER Protein Class (1)

PDB

2M55   1XQ8   2JN5   2KKW   2N0A   2X6M   3Q25   3Q26   3Q27   3Q28   3Q29   4BXL   4R0U   4R0W   4RIK   4RIL   4ZNN   5CRW  

  Ortholog (10)

 GWAS Trait (1)

Gene RIF (1220)

PMID Text
27228655 Alleles "G" of rs356165 and rs356219 were associated with increased levels of SNCA expression and high alpha-synuclein levels rs356165 and rs356219 variants might influence on Parkinson's disease development by upregulating SNCA expression.
27101974 The results of this study demonstrate that Fasudil, next to its effects mediated by ROCK-inhibition, directly interacts with alpha-Syn and attenuates alpha-Syn pathology
27098685 An alpha-synuclein mutant inhibited two forms of endocytosis, slow and rapid, in central nerve terminals.
27096366 identification of a common Parkinson's disease associated risk variant in a non-coding distal enhancer element that regulates the expression of alpha-synuclein (SNCA), a key gene implicated in the pathogenesis of Parkinson's disease
27019408 Our findings indicate that dGBA1b plays an important role in the metabolism of protein aggregates, but that the deleterious consequences of mutations in dGBA1b are largely independent of a-synuclein
27011009 In Parkinson's Disease, decreased salivary concentration of alpha-synuclein total may reflect the reduction of alpha-synuclein monomers, as well as the formation of insoluble intracellular inclusions and soluble oligomers.
27004367 This review examines the role of alpha-synuclein on microglia in Parkinson's disease pathogenesis and progression--{REVIEW}
26852372 the aggregation of alpha-synuclein results in toxicity because of loss of necessary alpha-synuclein function at the presynaptic terminal--{REVIEW}
26846854 Chemical cross-linking in combination with solution-state NMR and multiangle static light scattering (MALS) of alpha-Syn particles reveal a high-order protein-lipid entity composed of approximately 8-10 alpha-Syn molecules.
26845568 Our work provides new insights into the complex conformational reorganization occurring during acetylated a-synuclein amyloid formation
More...

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV      1 - 70
VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA     71 - 140
//

Text Mined References (1255)

PMID Year Title
27228655 2016 [SNCA rs356219 AND rs356165 VARIANTS ARE ASSOCIATED WITH PARKINSON'S DISEASE AND INCREASED ALPHA-SYNUCLEIN GENE EXPRESSION IN THE CD45(+)-BLOOD CELLS].
27101974 2016 Fasudil attenuates aggregation of ?-synuclein in models of Parkinson's disease.
27098685 2016 ?-Synuclein Mutation Inhibits Endocytosis at Mammalian Central Nerve Terminals.
27096366 2016 Parkinson-associated risk variant in distal enhancer of ?-synuclein modulates target gene expression.
27019408 2016 Glucocerebrosidase Deficiency in Drosophila Results in ?-Synuclein-Independent Protein Aggregation and Neurodegeneration.
27011009 2016 Abnormal Salivary Total and Oligomeric Alpha-Synuclein in Parkinson's Disease.
27004367 2016 Extracellular ?-synuclein--a possible initiator of inflammation in Parkinson's disease.
26852372 2016 The contribution of alpha synuclein to neuronal survival and function - Implications for Parkinson's disease.
26846854 2016 Preparation and Characterization of Stable ?-Synuclein Lipoprotein Particles.
26845568 2016 Structural remodeling during amyloidogenesis of physiological N?-acetylated ?-synuclein.
More...