Property Summary

NCBI Gene PubMed Count 36
PubMed Score 380.19
PubTator Score 174.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
hepatocellular carcinoma 547

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.205 1.8e-07
Breast cancer 1.400 9.8e-06
breast carcinoma 2.000 1.9e-03
dermatomyositis 1.100 6.3e-04
osteosarcoma -1.938 8.1e-06
ovarian cancer -1.200 5.0e-05
psoriasis 1.500 7.3e-04
tuberculosis 1.900 1.8e-09
Waldenstrons macroglobulinemia 1.666 4.8e-03

Protein-protein Interaction (7)

Gene RIF (17)

AA Sequence

MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR      1 - 70
KLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRIL     71 - 140
IKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLE    141 - 210
DPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ    211 - 280
ASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK                 281 - 337
//

Text Mined References (41)

PMID Year Title