Property Summary

NCBI Gene PubMed Count 36
Grant Count 193
R01 Count 133
Funding $46,839,015.04
PubMed Score 353.75
PubTator Score 174.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.666 0.005
psoriasis 1.500 0.001
osteosarcoma -1.938 0.000
acute quadriplegic myopathy 1.205 0.000
tuberculosis 1.900 0.000
breast carcinoma 2.000 0.002
ovarian cancer 3.300 0.000
Breast cancer 1.400 0.000
dermatomyositis 1.100 0.001

Synonym

Accession P37837 B2R8M2 O00751 Q8WV32 Q8WZ45
Symbols TAL
TALH
TAL-H
TALDOR

Gene

PDB

1F05  

Gene RIF (17)

PMID Text
25388407 The above findings support the premise that biallelic mutations in TALDO1 are responsible for transaldolase deficiency and confirm the broad phenotypic variability of this condition, even with the same genotype.
23736541 Data suggest that exchange reactions during gluconeogenesis catalyzed by transaldolase and triose-phosphate isomerase do not differ between subjects with type 2 diabetes and control subjects under fasting or hyperglycemic conditions.
23315216 This study expands the clinical definition of transaldolase deficiency, and adds to its allelic heterogeneity.
22510381 renal phenotype of patients with transaldolase deficiency
21062960 these data provide strong experimental evidence that transaldolase exchange occurs in humans, resulting in an overestimate of gluconeogenesis
20600873 Data show that erythronic acid was identified as a major abnormal metabolite in all patients and in knock-out TALDO mice implicating an as yet unknown biochemical pathway in this disease.
20194725 granzyme B-cleaved transaldolase-specific T cell-mediated cytotoxicity may contribute to the progressive destruction of oligodendrocytes in patients with multiple sclerosis
18805652 genetic polymorphisms in Transaldolase 1 are associated with squamous cell carcinoma of the head and neck .
18805652 Observational study of gene-disease association. (HuGE Navigator)
18687684 analysis of enzymes TalB and Taldo1 in human and E. coli
More...

AA Sequence

MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR      1 - 70
KLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRIL     71 - 140
IKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLE    141 - 210
DPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ    211 - 280
ASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERMFNAENGK                 281 - 337
//

Text Mined References (41)

PMID Year Title
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
25388407 2015 Transaldolase deficiency caused by the homozygous p.R192C mutation of the TALDO1 gene in four Emirati patients with considerable phenotypic variability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23736541 2013 Effects of transaldolase exchange on estimates of gluconeogenesis in type 2 diabetes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23315216 2013 Transaldolase deficiency: report of 12 new cases and further delineation of the phenotype.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22510381 2012 Nephrological abnormalities in patients with transaldolase deficiency.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...