Property Summary

NCBI Gene PubMed Count 35
PubMed Score 32.36
PubTator Score 30.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis -1.800 0.000
glioblastoma 2.500 0.007
posterior fossa group A ependymoma 2.500 0.000
primary pancreatic ductal adenocarcinoma 1.206 0.039
colon cancer 1.300 0.000
pancreatic cancer 1.500 0.009
pediatric high grade glioma 2.300 0.000
pilocytic astrocytoma 1.200 0.000
lung adenocarcinoma 1.142 0.000
COPD -1.200 0.001
lung carcinoma -1.800 0.000
acute myeloid leukemia 1.400 0.009
dermatomyositis -1.200 0.000

Gene RIF (13)

PMID Text
26414725 It is a target gene of miR-1.
26176734 Salvianolic acid A can reverse the paclitaxel resistance and inhibit the migration and invasion abilities of human breast cancer cells by down-regulating the expression of transgelin 2.
26081836 Proteomics result showed TAGLN2 as the most significant overexpression in individual bladder cancer tissues and urine specimens, and thus represents a potential biomarker for noninvasive screening for bladder cancer.
25914232 HIV-1 (NL4-3) infection inhibits palmitoylation of TAGLN2 in CEMx174 cells
25421410 TAGLN2 modulates hypoxia-induced apoptosis via caspase-8 apoptotic pathway. Taken together, our data demonstrated the roles of miR-133a in hypoxia-induced apoptotic and implicate its potential in cardiac dysfunctions therapy.
24476357 Transgelin-2, a sequence homolog of transgelin, whose role in the tumor development might be contradictory to the role of transgelin.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of transgelin 2 (TAGLN2) expression by HIV-1 Vpr in Vpr transduced macrophages
23527717 PTTG1 and TAGLN2 are highly expressed in human pancreatic cancer, and the positive expression of PTTG1 is associated with the gender of cancer patients, suggesting that it may represent a potential therapeutic target for the treatment of pancreatic cancer
21577206 our data propose a novel, oncogene-tumor suppressor interplay, where oncogenic PFTK1 confers HCC cell motility through inactivating the actin-binding motile suppressing function of TAGLN2 via phosphorylation.
21378409 Data indicate that TAGLN2 may have an oncogenic function and may be regulated by miR-1, a tumor suppressive miRNA in HNSCC.
More...

AA Sequence

MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALY      1 - 70
PEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARD     71 - 140
DGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL               141 - 199
//

Text Mined References (48)

PMID Year Title
26414725 2016 The tumor-suppressive function of miR-1 by targeting LASP1 and TAGLN2 in esophageal squamous cell carcinoma.
26176734 2015 Salvianolic acid A reverses the paclitaxel resistance and inhibits the migration and invasion abilities of human breast cancer cells by inactivating transgelin 2.
26081836 2015 Comparative Tissue Proteomics of Microdissected Specimens Reveals Novel Candidate Biomarkers of Bladder Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25421410 2015 miR-133a mediates the hypoxia-induced apoptosis by inhibiting TAGLN2 expression in cardiac myocytes.
24476357 2014 Transgelins, cytoskeletal proteins implicated in different aspects of cancer development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...