Property Summary

NCBI Gene PubMed Count 39
PubMed Score 36.73
PubTator Score 30.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.400 8.9e-03
Astrocytoma, Pilocytic 1.200 3.1e-05
colon cancer 1.300 2.9e-04
COPD -1.200 6.3e-04
dermatomyositis -1.200 1.8e-04
ependymoma 2.400 3.3e-18
glioblastoma 1.800 1.5e-06
lung adenocarcinoma 1.142 2.9e-05
lung carcinoma -1.800 1.3e-27
malignant mesothelioma -1.200 4.2e-06
pancreatic cancer 1.200 1.9e-06
pediatric high grade glioma 2.300 1.7e-07
primary pancreatic ductal adenocarcinoma 1.206 3.9e-02
psoriasis 1.300 1.2e-02

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALY      1 - 70
PEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARD     71 - 140
DGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL               141 - 199
//

Text Mined References (53)

PMID Year Title