Property Summary

NCBI Gene PubMed Count 75
Grant Count 73
R01 Count 26
Funding $8,767,279.25
PubMed Score 202.04
PubTator Score 155.57

Knowledge Summary

Patent (3,152)

Expression

Synonym

Accession P37288 V1aR
Symbols V1aR
AVPR1
AVPR V1a

Gene

PANTHER Protein Class (2)

PDB

1YTV  

  TechDev Info (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
2797 screening 815 / 0 / 324043 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based primary cell-based high throughput assay to identify agonists of the vasopressin 1 receptor (V1R)
434964 screening 29 / 0 / 146 Fluorescence-based cell-based high throughput confirmation assay for agonists of the vasopressin 1 receptor (V1R)
434991 screening 47 / 0 / 339 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based cell-based high throughput screening assay to identify agonists of the vasopressin 1 receptor (V1R), in triplicate
463108 confirmatory 2 / 0 / 20 Counterscreen for Oxytocin Receptor (OXTR) agonists: Fluorescence-based cell-based high throughput dose response assay to identify agonists of the vasopressin 1 receptor (V1R)
463127 confirmatory 7 / 0 / 5 Fluorescence-based cell-based high throughput dose response screening assay for agonists of the vasopressin 1 receptor (V1R)
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (66)

PMID Text
26295806 Higher acute vulnerability to stress exists in persons with long AVPR1A RS3 alleles and increased arginine vasopressin levels.
25968600 Study identified, in OXTR and AVPR1A genes, signatures of balancing selection in the cis-regulative acting sequences such as transcription factor binding and enhancer sequences, as well as in a transcriptional repressor sequence motif. Additionally, in the intron 3 of the OXTR gene, the SNP rs59190448 appears to be under positive directional selection.
25707602 The arginine vasopressin receptor 1A gene (AVPR1A) is known to affect social communication and has been reported to associate with autism in several studies.
25529259 AVPR1A RS3 was not associated with schizophrenia; variation in the AVPR1A gene contributes to social behavioral deficits associated with schizophrenia
25476609 examined associations between polymorphisms in OXTR and AVPR1a and individual differences in emotional and cognitive empathy 367 young adults; emotional empathy was associated solely with OXTR, whereas cognitive empathy was associated solely with AVPR1a
25438555 Haplotype analysis revealed an association of AVPR1A C*S- and C*L-haplotype (rs11174811 and RS1, respectively) and increased or decreased Extraversion (EPI) in Bashkirs, respectively.
25016245 Study found that variability in the rs7298346 marker, located in the 5'-flanking region, was related to a composite measure of executive functioning in 4-year-old children after controlling for a variety of covariates and children's theory of mind.
24924430 humanized AVPR1A mice displayed increased reciprocal social interactions compared with wild-type animals.
24849541 Gene-level tests showed that DRD2 was associated with vocabulary, ASPM with vocabulary and reading decoding, and AVPR1A with all three endophenotypes.
24660771 Men, but not women, with high levels of poststressor AVP and the 320 allele of the RS1 polymorphism reported more poststressor anger than noncarriers.
More...

AA Sequence

MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKLEIAVLAVTFAVAVLGNS      1 - 70
SVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAY     71 - 140
MLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIEVNNVTKARDCWATFIQP    141 - 210
WGSRAYVTWMTGGIFVAPVVILGTCYGFICYNIWCNVRGKTASRQSKGAEQAGVAFQKGFLLAPCVSSVK    211 - 280
SISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWIYMF    281 - 350
FSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST      351 - 418
//

Text Mined References (76)

PMID Year Title
26295806 2015 Impact of Childhood Adversity and Vasopressin receptor 1a Variation on Social Interaction in Adulthood: A Cross-Sectional Study.
25968600 2015 Signatures of positive selection in the cis-regulatory sequences of the human oxytocin receptor (OXTR) and arginine vasopressin receptor 1a (AVPR1A) genes.
25707602 2015 Association and Promoter Analysis of AVPR1A in Finnish Autism Families.
25529259 2015 Arginine vasopressin 1a receptor RS3 promoter microsatellites in schizophrenia: a study of the effect of the "risk" allele on clinical symptoms and facial affect recognition.
25476609 2015 Oxytocin receptor and vasopressin receptor 1a genes are respectively associated with emotional and cognitive empathy.
25438555 2014 [Arginine-vasopressin receptor gene (AVPR1A, AVPR1B) polymorphisms and their relation to personality traits].
25016245 2014 Association between the arginine vasopressin receptor 1A (AVPR1A) gene and preschoolers' executive functioning.
24924430 2014 Introduction of the human AVPR1A gene substantially alters brain receptor expression patterns and enhances aspects of social behavior in transgenic mice.
24849541 2014 Association between AVPR1A, DRD2, and ASPM and endophenotypes of communication disorders.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
More...