Property Summary

NCBI Gene PubMed Count 40
Grant Count 85
R01 Count 72
Funding $16,323,974.66
PubMed Score 343.26
PubTator Score 70.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P37268 B3KQ95 B4DJE5 B4DT56 B7Z1J3 Q96GT0 SQS
Symbols SS
SQS
DGPT
ERG9

Gene

PDB

1EZF   3ASX   3LEE   3Q2Z   3Q30   3V66   3VJ8   3VJ9   3VJA   3VJB   3VJC   3WC9   3WCD   3WCF   3WCH   3WCI   3WCJ   3WCL   3WCM   3WEF   3WEG   3WEH   3WEI   3WEJ   3WEK   3WSA  

Gene RIF (28)

PMID Text
25152164 Up-regulation of SQS promotes metastasis of lung cancer by enhancing tumor necrosis factor-alpha receptor 1 and nuclear factor-kappaB activation and matrix metallopeptidase 1 expression.
24690320 HCV infection increases FDFT1 protein level but not FDFT1 mRNA level.
24531458 Several critical residues that are involved in binding of NADPH have been identified in the active site of squalene synthase.
24333579 this finding yields a new method of colorimetric screening for the cellular activity of squalene synthases, which are major targets for cholesterol-lowering drugs.
23870067 The minor allele in FDFT1 was associated with advanced fibrosis in the non-steatotic but not in the steatotic subgroup in patients with chronic hepatitis C.
23557589 ABHD5, PGRMC1 and SQS are novel markers for sebaceous carcinoma and can reliably distinguish sebaceous neoplasms from non-sebaceous tumors, specifically BCC with clear cell features.
22546838 FDFT1 and its encoded enzyme, squalene synthase, may play an important role in prostate cancer development and its aggressive phenotypes.
21945151 CTSB and FDFT1 are excluded as candidates for keratolytic winter erythema
21439984 NASH is intimately related to fibrosis progression, the FDFT1 SNP is a good candidate for a link with inflammation and fibrosis.
20708005 In multivariate models adjusted for age, body mass index, diabetes, waist/hip ratios, and levels of glycated hemoglobin, the NAFLD activity score was associated with the SNP rs2645424 on chromosome 8 in farnesyl diphosphate farnesyl transferase 1 (FDFT1)
More...

AA Sequence

MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVC      1 - 70
IFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQ     71 - 140
TVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF    141 - 210
LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL    211 - 280
RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP    281 - 350
DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH       351 - 417
//

Text Mined References (44)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25152164 2014 Squalene synthase induces tumor necrosis factor receptor 1 enrichment in lipid rafts to promote lung cancer metastasis.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24690320 2014 Farnesyl-diphosphate farnesyltransferase 1 regulates hepatitis C virus propagation.
24531458 2014 Structural insights into the catalytic mechanism of human squalene synthase.
24333579 2014 Construction of carotenoid biosynthetic pathways using squalene synthase.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23870067 2014 Role of FDFT1 polymorphism for fibrosis progression in patients with chronic hepatitis C.
23557589 2013 Lipid synthesis and processing proteins ABHD5, PGRMC1 and squalene synthase can serve as novel immunohistochemical markers for sebaceous neoplasms and differentiate sebaceous carcinoma from sebaceoma and basal cell carcinoma with clear cell features.
More...