Property Summary

Ligand Count 151
NCBI Gene PubMed Count 42
PubMed Score 374.28
PubTator Score 70.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Protein-protein Interaction (4)

Gene RIF (29)

AA Sequence

MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVC      1 - 70
IFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQ     71 - 140
TVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLF    141 - 210
LQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRL    211 - 280
RNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP    281 - 350
DSDPSSSKTRQIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH       351 - 417
//

Text Mined References (46)

PMID Year Title