Property Summary

NCBI Gene PubMed Count 28
PubMed Score 15.72
PubTator Score 19.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 7.1867954335054E-20
posterior fossa group B ependymoma 1530 1.79122819411085E-15
non-small cell lung cancer 2798 1.81573311961775E-15
lung adenocarcinoma 2714 3.41383583313372E-11
ovarian cancer 8492 3.92698248426359E-11
cystic fibrosis 1670 1.35169485435144E-7
malignant mesothelioma 3163 1.5229301047051E-7
sonic hedgehog group medulloblastoma 1482 3.57235079931945E-7
glioblastoma 5572 9.43199427077658E-7
atypical teratoid / rhabdoid tumor 4369 2.11063673135504E-6
pituitary cancer 1972 3.4599277174104E-6
pilocytic astrocytoma 3086 1.38527108243787E-5
adult high grade glioma 2148 1.80651962465524E-4
lung cancer 4473 0.00150418832662921
medulloblastoma, large-cell 6234 0.00205011925250424
subependymal giant cell astrocytoma 2287 0.00286085946069272
Rheumatoid Arthritis 1171 0.00357114061174338
astrocytic glioma 2241 0.00640672788356871
oligodendroglioma 2849 0.00875173500771112
primitive neuroectodermal tumor 3031 0.030255839483242
active ulcerative colitis 477 0.0348921050987158

Expression

  Differential Expression (21)

Synonym

Accession P37235 Q969S5
Symbols BDR1
HLP2
VILIP-3

Gene

  Ortholog (13)

Gene RIF (8)

PMID Text
26659654 Secreted HPCAL1 protein in the plasma dropped dramatically in hepatocellular carcinoma patients relative to controls.
25019684 Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane.
23873030 HPCAL1 did not appreciably influence the ability of WT PHOX2B.
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16703469 The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement.
15834280 Observational study of gene-disease association. (HuGE Navigator)
14739275 visinin-like protein-3 interacts with microsomal cytochrome b5 in a Ca2+-dependent manner
11173883 VILIP-3 immunostaining was found to be reduced in Alzheimer brains; immunoreactive material was detected in close association with amyloid plaques and neurofibrillar tangles, typical pathologic hallmarks of AD

AA Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (31)

PMID Year Title
26659654 2016 Hippocalcin-like 1 suppresses hepatocellular carcinoma progression by promoting p21(Waf/Cip1) stabilization by activating the ERK1/2-MAPK pathway.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25019684 2014 Specific interaction to PIP2 increases the kinetic rate of membrane binding of VILIPs, a subfamily of Neuronal Calcium Sensors (NCS) proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23873030 2014 Mutations that disrupt PHOXB interaction with the neuronal calcium sensor HPCAL1 impede cellular differentiation in neuroblastoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
More...