Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
Funding $926,801
PubMed Score 15.72
PubTator Score 19.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (8)

PMID Text
26659654 Secreted HPCAL1 protein in the plasma dropped dramatically in hepatocellular carcinoma patients relative to controls.
25019684 Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane.
23873030 HPCAL1 did not appreciably influence the ability of WT PHOX2B.
21059989 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16703469 The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement.
15834280 Observational study of gene-disease association. (HuGE Navigator)
14739275 visinin-like protein-3 interacts with microsomal cytochrome b5 in a Ca2+-dependent manner
11173883 VILIP-3 immunostaining was found to be reduced in Alzheimer brains; immunoreactive material was detected in close association with amyloid plaques and neurofibrillar tangles, typical pathologic hallmarks of AD

AA Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFR      1 - 70
TFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPE     71 - 140
DESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF                     141 - 193
//

Text Mined References (31)

PMID Year Title
26659654 2016 Hippocalcin-like 1 suppresses hepatocellular carcinoma progression by promoting p21(Waf/Cip1) stabilization by activating the ERK1/2-MAPK pathway.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25019684 2014 Specific interaction to PIP2 increases the kinetic rate of membrane binding of VILIPs, a subfamily of Neuronal Calcium Sensors (NCS) proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23873030 2014 Mutations that disrupt PHOXB interaction with the neuronal calcium sensor HPCAL1 impede cellular differentiation in neuroblastoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21059989 2011 Identification of novel loci for Alzheimer disease and replication of CLU, PICALM, and BIN1 in Caribbean Hispanic individuals.
More...