Property Summary

Ligand Count 981
NCBI Gene PubMed Count 1,791
PubMed Score 9579.50
PubTator Score 4693.16

Knowledge Summary

Patent (119,840)

TINX Plot

  Disease (8)

Disease Target Count
Hyperglycemia 137
Lipodystrophy 40
Hyperinsulinism 133
Alzheimer's disease 658
Abnormal pigmentation 25
Abnormality of the face 10
Abnormality of the musculature 16
Acanthosis Nigricans 27
Acromegaly 51
Advanced bone age 35
Autosomal recessive predisposition 1442
Bone Cysts 12
Broad feet 19
Class III malocclusion 78
Congenital anomaly of face 56
Congenital anomaly of neck 19
Decreased resting energy expenditure 4
Decreased subcutaneous adipose tissue 13
Deformity of neck 19
Degenerative polyarthritis 115
Diabetes Mellitus, Non-Insulin-Dependent 145
Disorder of face 10
Dull intelligence 645
Familial Partial Lipodystrophy, Type 3 1
Generalized hirsutism 36
Gestational diabetes 26
Giant Cell Glioblastoma 12
Glioma 74
Growth hormone excess 14
Hepatomegaly 285
High density lipoprotein decreased 10
Highly variable clinical phenotype 150
Highly variable phenotype and severity 150
Highly variable phenotype, even within families 150
Hirsutism 47
Hyperhidrosis disorder 81
Hyperplasia of supraorbital margins 19
Hyperplasia of supraorbital ridge 19
Hypertensive disease 292
Hypertriglyceridemia result 37
Hypertrophic Cardiomyopathy 117
Hypertrophy of lower jaw 78
Hypertrophy of supraorbital margins 19
Hypertrophy of supraorbital ridge 19
Hyperuricemia 49
Hypoalphalipoproteinemias 10
Increase in blood pressure 119
Increased carotid artery intimal medial thickness 1
Increased size of mandible 78
Increased sweating 81
Insulin resistant diabetes 13
Intellectual disability 1016
Large hand 18
Lipoatrophic Diabetes Mellitus 5
Lipoatrophy 19
Lipoidosis 19
Liver Cirrhosis 181
Liver Failure 73
Liver carcinoma 240
Loss of gluteal subcutaneous adipose tissue 4
Loss of subcutaneous adipose tissue in limbs 6
Low intelligence 645
Malformation of the neck 19
Mandibular hyperplasia 78
Marked muscular hypertrophy 2
Mental Retardation 645
Mental deficiency 645
Mood Disorders 184
Oligomenorrhea 16
Pancreatic Neoplasm 85
Papillary thyroid carcinoma 43
Phenotypic variability 150
Poor school performance 645
Pre-Eclampsia 68
Precocious Puberty 28
Primary physiologic amenorrhea 55
Prominent superficial veins 3
Prominent supraorbital ridges 19
Schizophrenia 1160
Secondary physiologic amenorrhea 32
Skeletal muscle hypertrophy 16
Steatohepatitis 44
Sweating 81
T-Cell Lymphoma 13
Thin skin 47
Thyroid Neoplasm 37
Xanthomatosis 12
gliosarcoma 18
mandibular excess (physical finding) 78
maternal hyperglycemia 3
pituitary-dependent Cushing's disease 5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.4
Type 2 diabetes mellitus 272 0.0 1.5

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis -1.300 2.8e-06
active ulcerative colitis -1.055 2.0e-02
Atopic dermatitis -1.400 5.9e-03
breast carcinoma -2.300 6.1e-04
ductal carcinoma in situ -2.900 2.5e-04
ependymoma 1.300 9.6e-03
esophageal adenocarcinoma 1.200 3.0e-02
fibroadenoma -2.800 1.1e-02
group 4 medulloblastoma -1.100 9.2e-05
interstitial cystitis -2.200 6.9e-03
intraductal papillary-mucinous adenoma (... 1.900 3.7e-04
intraductal papillary-mucinous carcinoma... 1.500 2.7e-02
intraductal papillary-mucinous neoplasm ... 2.500 1.5e-03
invasive ductal carcinoma -1.066 8.2e-03
lung adenocarcinoma -1.700 1.5e-10
lung cancer -1.500 4.7e-03
lung carcinoma -2.700 1.9e-17
medulloblastoma, large-cell -1.300 2.0e-04
mucosa-associated lymphoid tissue lympho... 2.329 4.9e-02
non-small cell lung cancer -2.202 1.1e-20
osteosarcoma -1.655 8.3e-03
pancreatic cancer 1.500 2.4e-04
primitive neuroectodermal tumor -1.100 2.7e-03
tuberculosis -3.800 1.8e-09

Protein-protein Interaction (2)

PDB (160)

Gene RIF (1966)

AA Sequence

MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF      1 - 70
SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR     71 - 140
VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF    141 - 210
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM    211 - 280
NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV    281 - 350
HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII    351 - 420
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD    421 - 490
MSLHPLLQEIYKDLY                                                           491 - 505
//

Text Mined References (1806)

PMID Year Title