Property Summary

Ligand Count 930
NCBI Gene PubMed Count 1,791
PubMed Score 9579.50
PubTator Score 4693.16

Knowledge Summary

Patent (119,840)

TINX Plot

  Disease (8)

Disease Target Count
Hyperglycemia 137
Lipodystrophy 40
Hyperinsulinism 133
Alzheimer's disease 658
Abnormal pigmentation 25
Abnormality of the face 10
Abnormality of the musculature 16
Acanthosis Nigricans 27
Acromegaly 51
Advanced bone age 35
Autosomal recessive predisposition 1442
Bone Cysts 12
Broad feet 19
Class III malocclusion 78
Congenital anomaly of face 56
Congenital anomaly of neck 19
Decreased resting energy expenditure 4
Decreased subcutaneous adipose tissue 13
Deformity of neck 19
Degenerative polyarthritis 115
Diabetes Mellitus, Non-Insulin-Dependent 145
Disorder of face 10
Dull intelligence 645
Familial Partial Lipodystrophy, Type 3 1
Generalized hirsutism 36
Gestational diabetes 26
Giant Cell Glioblastoma 12
Glioma 74
Growth hormone excess 14
Hepatomegaly 285
High density lipoprotein decreased 10
Highly variable clinical phenotype 150
Highly variable phenotype and severity 150
Highly variable phenotype, even within families 150
Hirsutism 47
Hyperhidrosis disorder 81
Hyperplasia of supraorbital margins 19
Hyperplasia of supraorbital ridge 19
Hypertensive disease 292
Hypertriglyceridemia result 37
Hypertrophic Cardiomyopathy 117
Hypertrophy of lower jaw 78
Hypertrophy of supraorbital margins 19
Hypertrophy of supraorbital ridge 19
Hyperuricemia 47
Hypoalphalipoproteinemias 10
Increase in blood pressure 119
Increased carotid artery intimal medial thickness 1
Increased size of mandible 78
Increased sweating 81
Insulin resistant diabetes 13
Intellectual disability 1016
Large hand 18
Lipoatrophic Diabetes Mellitus 5
Lipoatrophy 19
Lipoidosis 19
Liver Cirrhosis 181
Liver Failure 73
Liver carcinoma 240
Loss of gluteal subcutaneous adipose tissue 4
Loss of subcutaneous adipose tissue in limbs 6
Low intelligence 645
Malformation of the neck 19
Mandibular hyperplasia 78
Marked muscular hypertrophy 2
Mental Retardation 645
Mental deficiency 645
Mood Disorders 184
Oligomenorrhea 16
Pancreatic Neoplasm 85
Papillary thyroid carcinoma 43
Phenotypic variability 150
Poor school performance 645
Pre-Eclampsia 68
Precocious Puberty 28
Primary physiologic amenorrhea 55
Prominent superficial veins 3
Prominent supraorbital ridges 19
Schizophrenia 1160
Secondary physiologic amenorrhea 32
Skeletal muscle hypertrophy 16
Steatohepatitis 44
Sweating 81
T-Cell Lymphoma 13
Thin skin 47
Thyroid Neoplasm 37
Xanthomatosis 12
gliosarcoma 18
mandibular excess (physical finding) 78
maternal hyperglycemia 3
pituitary-dependent Cushing's disease 5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.4
Type 2 diabetes mellitus 272 0.0 1.5

Expression

  Differential Expression (24)

Disease log2 FC p
psoriasis -1.300 2.8e-06
active ulcerative colitis -1.055 2.0e-02
Atopic dermatitis -1.400 5.9e-03
breast carcinoma -2.300 6.1e-04
ductal carcinoma in situ -2.900 2.5e-04
ependymoma 1.300 9.6e-03
esophageal adenocarcinoma 1.200 3.0e-02
fibroadenoma -2.800 1.1e-02
group 4 medulloblastoma -1.100 9.2e-05
interstitial cystitis -2.200 6.9e-03
intraductal papillary-mucinous adenoma (... 1.900 3.7e-04
intraductal papillary-mucinous carcinoma... 1.500 2.7e-02
intraductal papillary-mucinous neoplasm ... 2.500 1.5e-03
invasive ductal carcinoma -1.066 8.2e-03
lung adenocarcinoma -1.700 1.5e-10
lung cancer -1.500 4.7e-03
lung carcinoma -2.700 1.9e-17
medulloblastoma, large-cell -1.300 2.0e-04
mucosa-associated lymphoid tissue lympho... 2.329 4.9e-02
non-small cell lung cancer -2.202 1.1e-20
osteosarcoma -1.655 8.3e-03
pancreatic cancer 1.500 2.4e-04
primitive neuroectodermal tumor -1.100 2.7e-03
tuberculosis -3.800 1.8e-09

Synonym

Accession P37231 A8K3G6 B5BUA1 O00684 O00710 O14515 Q0QJH8 Q15178 Q15179 Q15180 Q15832 Q86U60 Q96J12 PPAR-gamma
Symbols GLM1
CIMT1
NR1C3
PPARG1
PPARG2
PPARgamma

Gene

PDB

1FM6   1FM9   1I7I   1K74   1KNU   1NYX   1PRG   1RDT   1WM0   1ZEO   1ZGY   2ATH   2F4B   2FVJ   2G0G   2G0H   2GTK   2HFP   2HWQ   2HWR   2I4J   2I4P   2I4Z   2OM9   2P4Y   2POB   2PRG   2Q59   2Q5P   2Q5S   2Q61   2Q6R   2Q6S   2Q8S   2QMV   2VSR   2VST   2VV0   2VV1   2VV2   2VV3   2VV4   2XKW   2YFE   2ZK0   2ZK1   2ZK2   2ZK3   2ZK4   2ZK5   2ZK6   2ZNO   2ZVT   3ADS   3ADT   3ADU   3ADV   3ADW   3ADX   3AN3   3AN4   3B0Q   3B0R   3B1M   3B3K   3BC5   3CDP   3CDS   3CS8   3CWD   3D6D   3DZU   3DZY   3E00   3ET0   3ET3   3FEJ   3FUR   3G9E   3GBK   3H0A   3HO0   3HOD   3IA6   3K8S   3KMG   3LMP   3NOA   3OSI   3OSW   3PBA   3PO9   3PRG   3QT0   3R5N   3R8A   3R8I   3S9S   3SZ1   3T03   3TY0   3U9Q   3V9T   3V9V   3V9Y   3VJH   3VJI   3VN2   3VSO   3VSP   3WJ4   3WJ5   3WMH   3X1H   3X1I   4A4V   4A4W   4CI5   4E4K   4E4Q   4EM9   4EMA   4F9M   4FGY   4HEE   4JAZ   4JL4   4L96   4L98   4O8F   4OJ4   4PRG   4PVU   4PWL   4R06   4R2U   4R6S   4XLD   4XTA   4XUH   4XUM   4Y29   4YT1   5AZV   5DSH   5DV3   5DV6   5DV8   5DVC   5DWL   5F9B   5GTN   5GTO   5GTP   5HZC   5JI0   5LSG   5TTO   5TWO   5U5L  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (1966)

AA Sequence

MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF      1 - 70
SSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECR     71 - 140
VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF    141 - 210
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM    211 - 280
NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV    281 - 350
HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII    351 - 420
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETD    421 - 490
MSLHPLLQEIYKDLY                                                           491 - 505
//

Text Mined References (1806)

PMID Year Title