Property Summary

NCBI Gene PubMed Count 79
PubMed Score 62.49
PubTator Score 556.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Striatonigral degeneration infantile 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Irritable bowel syndrome 60 3.318 1.7
Striatonigral degeneration 3 3.062 1.5

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.400 4.6e-04
astrocytoma 1.800 1.5e-03
atypical teratoid / rhabdoid tumor 1.300 6.6e-04
group 3 medulloblastoma 1.700 9.0e-05
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
lung cancer 1.400 1.5e-04
medulloblastoma, large-cell 1.500 1.9e-04
non-small cell lung cancer 1.145 2.3e-14
osteosarcoma -1.345 1.4e-03
ovarian cancer 1.100 1.0e-06

 MGI Phenotype (1)

Gene RIF (25)

AA Sequence

MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQ      1 - 70
TTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGF     71 - 140
VFGPSTTSVAPATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTP    141 - 210
TATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATAT    211 - 280
TTSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERH    281 - 350
FLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGT    351 - 420
IYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQ    421 - 490
NSALLQRKVEEVTKVCEGRRKEQERSFRITFD                                          491 - 522
//

Text Mined References (90)

PMID Year Title