Property Summary

NCBI Gene PubMed Count 404
Grant Count 212
R01 Count 154
Funding $19,072,756.29
PubMed Score 519.26
PubTator Score 615.96

Knowledge Summary

Patent (16,731)

TINX Plot

  Disease Relevance (70)

Disease Z-score Confidence
Loeys-Dietz syndrome 23 6.701 3.4
Cancer 2,346 4.916 2.5
Aortic aneurysm 34 4.42 2.2
Lynch syndrome 33 4.302 2.2
Cleft palate 125 4.003 2.0
Connective tissue disease 59 3.324 1.7
Adenoma 165 3.287 1.6
Aneurysm, Dissecting 5
Aortic Aneurysm, Thoracic 6
Aortic aneurysm, familial thoracic 3 1
Becker muscular dystrophy 187
Bone Diseases 8
Bone neoplasms 7
Breast cancer 3,094 2.0
COLORECTAL CANCER, HEREDITARY NONPOLYPOS... 1 
COPD 113
Colonic Neoplasms 126
Congenital aneurysm of ascending aorta 3
Craniofacial Abnormalities 147
Diabetic Nephropathy 37
Duchenne muscular dystrophy 602
Esophageal Neoplasms 67
Esophageal carcinoma 5
Eye Abnormalities 15
Fatigue 4
Gaucher disease type 1 171
Hereditary Nonpolyposis Colorectal Cance... 13 
Hereditary Nonpolyposis Colorectal Neopl... 8 
Hernia, Inguinal 1
LOEYS-DIETZ SYNDROME, TYPE 1B 1
Liver Cirrhosis, Experimental 108
Lung Neoplasms 171
Malignant neoplasm of breast 63
Malignant neoplasm of esophagus 18
Marfan Syndrome 14
Marfan Syndrome type 2 1
Microsatellite Instability 12
Migraine 79 2.0
Migraine Disorders 26
Neoplasm Metastasis 138
Prostatic Neoplasms 471
Thoracic aortic aneurysm 12 5.0
Vascular disease 281 2.0
Waldenstrons macroglobulinemia 765
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cystic fibrosis 1,665
dermatomyositis 933
ductal carcinoma in situ 1,745
glioblastoma 5,572
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
mucosa-associated lymphoid tissue lympho... 480 
nephrosclerosis 329
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group B ependymoma 1,530
sonic hedgehog group medulloblastoma 1,482

Expression

Synonym

Accession P37173 B4DTV5 Q15580 Q6DKT6 Q99474 TGFR-2
Symbols AAT3
FAA3
LDS2
MFS2
RIIC
LDS1B
LDS2B
TAAD2
TGFR-2
TGFbeta-RII

Gene

PDB

1KTZ   1M9Z   1PLO   2PJY   3KFD   4P7U   4XJJ   5E8V   5E8Y   5E91   5E92  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (332)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26867007 AT2R downregulates the expression of TGF-betaRII in human proximal tubule cells
26823785 results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer.
26780887 Reduced expression of TGF-beta type II receptor and extracellular matrix components in response to reduced fibroblast size/mechanical force was fully reversed by restoring size/mechanical force
26652004 This work details a novel mechanism by which cellular tension regulates TGFbeta receptor organization, multimerization, and function.
26551005 High levels of TbetaRII expression were associated with lymph node metastasis, increasing tumor clinical stage, and poorer 5-year disease-free survival in patients with breast cancer. TbetaRII may be a potential prognostic marker for breast cancer.
26542979 MiR-1343 reduces the expression of both TGF-beta receptor 1 and 2 by directly targeting their 3'-UTRs.
26511382 TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26505114 Data (including data from studies in transgenic mice) suggest intraislet pancreatic duct cells are capable of giving rise to insulin-secreting beta-cells; Tgfbr2/transforming growth factor-beta type II receptor appears to involved in this process.
26498065 Findings suggest that the upregulation of miR-590-5p promotes cellular malignant behavior via the target gene TGFbetaRII in vulvar squamous cell carcinoma.
More...

AA Sequence

MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSN      1 - 70
CSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS     71 - 140
DECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLM    141 - 210
EFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP    211 - 280
YEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL    281 - 350
GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG    351 - 420
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDN    421 - 490
VLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPED    491 - 560
GSLNTTK                                                                   561 - 567
//

Text Mined References (417)

PMID Year Title
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26867007 2016 Angiotensin II Type 2 Receptor Decreases Transforming Growth Factor-? Type II Receptor Expression and Function in Human Renal Proximal Tubule Cells.
26823785 2015 Expression of CDKN1A/p21 and TGFBR2 in breast cancer and their prognostic significance.
26780887 2016 Reduction of fibroblast size/mechanical force down-regulates TGF-? type II receptor: implications for human skin aging.
26652004 2015 Discrete spatial organization of TGF? receptors couples receptor multimerization and signaling to cellular tension.
26551005 2015 Clinical Implications of T?RII Expression in Breast Cancer.
26542979 2016 miR-1343 attenuates pathways of fibrosis by targeting the TGF-? receptors.
26511382 2015 TGF-?2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26505114 2016 Intraislet Pancreatic Ducts Can Give Rise to Insulin-Positive Cells.
More...