Property Summary

Ligand Count 4
NCBI Gene PubMed Count 438
PubMed Score 665.12
PubTator Score 615.96

Knowledge Summary

Patent (16,731)

TINX Plot

  Disease (7)

Disease Target Count
Abdominal Pain 98
Abnormality of the iris 14
Abnormality of the voice 46
Acquired flat foot 72
Acquired scoliosis 281
Aneurysm of ascending aorta 5
Anxiety 136
Anxiety disease 113
Aortic Valve Insufficiency 40
Aortic aneurysm, familial thoracic 3 13
Arachnodactyly 49
Arterial tortuosity 5
Arterial tortuosity, generalized 2
Ascending aortic dissection 13
Attention deficit hyperactivity disorder 278
Atypical scarring of skin 62
Blue sclera 32
Brachydactyly 156
Byzanthine arch palate 194
Cardiomegaly 116
Chest Pain 38
Cleft palate with cleft lip 23
Cleft uvula 27
Clinodactyly of the 5th toe 6
Congenital Camptodactyly 40
Congenital clubfoot 109
Constipation 181
Contracture of joint of hand 30
Coronary artery disease 268
Coughing 25
Craniosynostosis 74
Curvature of spine 282
Curvature of the little toe 6
Cutis marmorata 32
Cystic medial necrosis of aorta 13
Death in early adulthood 24
Death in early childhood 82
Death in infancy 82
Depressive disorder 409
Descending aortic dissection 13
Diabetic Nephropathy 34
Dissection of aorta 9
Dyschezia 135
Dyspnea on exertion 24
Dyspnea, Paroxysmal 13
Epilepsy 792
Esophageal carcinoma 16
Exophthalmos 112
Exotropia 35
Feeding difficulties in infancy 175
Flatfoot 73
Flexion contracture of proximal interphalangeal joint 75
Gastrointestinal Hemorrhage 52
Hereditary Nonpolyposis Colorectal Cancer 11
Hereditary Nonpolyposis Colorectal Neoplasms 8
Hereditary nonpolyposis colorectal carcinoma 18
Hypertensive disease 292
Hypoplastic mandible condyle 275
Hypotrophic malar bone 129
Impaired left ventricular function 16
Increase in blood pressure 119
Intermittent migraine headaches 68
Intracranial hypertension 32
Irritation - emotion 68
Joint laxity 54
Left-Sided Heart Failure 16
Linear atrophy 15
Loeys-Dietz Aortic Aneurysm Syndrome 13
Malabsorption 82
Malar flattening 129
Malignant Squamous Cell Neoplasm 17
Malignant tumor of colon 19
Mandibular hypoplasia 275
Marfan Syndrome type 2 1
Micrognathism 275
Muscle Hypertonia 88
Muscle hypotonia 571
Nausea and vomiting 97
Oral cleft 18
Orbital separation excessive 244
Patent ductus arteriosus 90
Prominent eyes 96
Prominent globes 96
Protruding eyes 96
Pulmonary artery aneurysm 2
Rectal Neoplasms 18
Retrognathia 54
Schizophrenia 1160
Seizures 596
Skull malformation 38
Squamous cell carcinoma 129
Sternal anomalies 19
Tall stature 34
Translucent skin 4
Uterine Rupture 2
Weight decreased 103
glioblastoma 5792
Disease Target Count Z-score Confidence
pancreatic cancer 2398 0.0 0.6

Expression

  Differential Expression (32)

Disease log2 FC p
Breast cancer -2.400 1.8e-15
glioblastoma 2.400 1.1e-04
active ulcerative colitis 1.338 1.1e-02
acute quadriplegic myopathy 1.507 8.5e-05
adrenocortical carcinoma -1.450 8.8e-04
Astrocytoma, Pilocytic 1.800 1.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.333 7.1e-03
Becker muscular dystrophy 1.002 1.8e-02
breast carcinoma -1.400 1.5e-04
COPD -1.100 6.2e-03
cystic fibrosis 2.504 2.3e-06
dermatomyositis 2.200 1.7e-03
Duchenne muscular dystrophy 1.708 6.3e-08
ductal carcinoma in situ -1.100 8.9e-03
ependymoma 1.100 3.8e-05
Gaucher disease type 1 -2.300 1.7e-02
invasive ductal carcinoma -2.200 1.7e-04
juvenile dermatomyositis 1.484 9.4e-10
limb girdle muscular dystrophy 2A 1.190 2.3e-04
lung adenocarcinoma -1.300 6.0e-17
lung cancer -1.600 6.5e-03
lung carcinoma -2.100 1.6e-21
malignant mesothelioma -2.000 3.5e-07
mucosa-associated lymphoid tissue lympho... 1.018 3.3e-02
nephrosclerosis 1.026 1.1e-03
non-small cell lung cancer -1.183 1.4e-08
osteosarcoma 1.792 1.9e-04
ovarian cancer -3.200 1.2e-09
pancreatic ductal adenocarcinoma liver m... -1.488 2.5e-02
pediatric high grade glioma 1.200 7.4e-03
sonic hedgehog group medulloblastoma 1.400 5.1e-04
Waldenstrons macroglobulinemia 1.012 2.5e-02

Gene RIF (365)

AA Sequence

MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSN      1 - 70
CSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS     71 - 140
DECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLM    141 - 210
EFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP    211 - 280
YEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKL    281 - 350
GSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG    351 - 420
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDN    421 - 490
VLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPED    491 - 560
GSLNTTK                                                                   561 - 567
//

Text Mined References (451)

PMID Year Title